dbPTM

LMCD1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	LMCD1_MOUSE
UniProt AC	Q8VEE1
Protein Name	LIM and cysteine-rich domains protein 1
Gene Name	Lmcd1
Organism	Mus musculus (Mouse).
Sequence Length	365
Subcellular Localization	Cytoplasm . Nucleus . May shuttle between the cytoplasm and the nucleus.
Protein Description	Transcriptional cofactor that restricts GATA6 function by inhibiting DNA-binding, resulting in repression of GATA6 transcriptional activation of downstream target genes. Represses GATA6-mediated trans activation of lung- and cardiac tissue-specific promoters. Inhibits DNA-binding by GATA4 and GATA1 to the cTNC promoter. Plays a critical role in the development of cardiac hypertrophy via activation of calcineurin/nuclear factor of activated T-cells signaling pathway..
Protein Sequence	MAKVAKDLNPGVQKMSLGQQQSARGVACLRCKGMCSGFEPHSWRKICKSCKCSQEEHCLSSDLDDDRKIGRLLMDSKYATLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEWAPPGVTQKLGLQYMELIPKERQPVTGTEGALYRRRQLMHQLPIYDQDPSRCRGLVENELKAMEEFVKHYKSEALGVGEVALPGQGGLPKEENKTQEKPEGTETTAPTTNGSLGDPSKEVEYVCELCKGAAPVDSPVVYADRAGYSKQWHPTCFQCIKCSEPLVDLIYFWKDGAPWCGRHYCESVRPRCSGCDEIIFSEDYQRVEDLAWHRKHFICEGCEQLLSGRAYIVTKGQLLCPTCSKSKRS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
6	Acetylation	--MAKVAKDLNPGVQ --CCCCHHHCCCCHH	66.78	23864654
14	Acetylation	DLNPGVQKMSLGQQQ HCCCCHHCCCCCCCC	28.22	23864654
16	Phosphorylation	NPGVQKMSLGQQQSA CCCHHCCCCCCCCCH	36.06	28464351
22	Phosphorylation	MSLGQQQSARGVACL CCCCCCCCHHCEEHH	18.65	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of LMCD1_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of LMCD1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of LMCD1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of LMCD1_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of LMCD1_MOUSE

Related Literatures of Post-Translational Modification