dbPTM

LKHA4_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	LKHA4_SCHPO
UniProt AC	O94544
Protein Name	Leucine aminopeptidase 2
Gene Name	lap2
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	612
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description	Aminopeptidase that preferentially cleaves di- and tripeptides. Also has low epoxide hydrolase activity (in vitro). Can hydrolyze the epoxide leukotriene LTA(4) but it forms preferentially 5,6-dihydroxy-7,9,11,14-eicosatetraenoic acid rather than the cytokine leukotriene B(4) as the product compared to the homologous mammalian enzyme (in vitro)..
Protein Sequence	MKLRLDPSTQSNYHDVSISKLDWHARIDFDQELLHGKVSFVIQSARVSQALSHIILDTSYLEIKNVTINDIPTPFRVDKRRGFLGSALHIVPADEIPSSKSCILTILYSTTKDCTALQFLKPEQTIGGKFPYVFSECQAIHARSFIPCQDTPSVKVPCTFKIRSKLPVIASGIPCGTANFCNGSLEYLFEQKNPIPSYLFCILSGDLASTNIGPRSSVYTEPGNLLACKYEFEHDMENFMEAAEQLTLPYCWTRYDFVILPPSFPYGGMENPNATFATPTLIAGDRSNVNVIAHELAHSWSGNLVTNESWQCFWLNEGMTVFLERKILGRLYGEPTRQFEAIIGWGELEESVKLLGEDSEYTKLIQNLEGRDPDDAFSTVPYEKGSNFLYEIERVIGGPSVFEPFLPFYFRKFAKSTVNEVKFKHALYEYFSPLGLASKLDSIDWDTWYHAPGMPPVKPHFDTTLADPCYKLAESWTNSAKNSDDPSKFSSKDIENWSAGQKSLFLDVVYEAVSFPHNYIKRMGDVYSFAESKNAELSFRFFKLALKSKYKPLYNTIAERVGSVGRMKFVRPIFRLLNEADRAFAIETFEKYKHFYHKICASQVEKDLGLSE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
17	Phosphorylation	QSNYHDVSISKLDWH CCCCCCCCHHHCCEE	27.48	29996109
19	Phosphorylation	NYHDVSISKLDWHAR CCCCCCHHHCCEEEE	21.47	29996109
611	Phosphorylation	VEKDLGLSE------ HHHHHCCCC------	39.19	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of LKHA4_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of LKHA4_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of LKHA4_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of LKHA4_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of LKHA4_SCHPO

Related Literatures of Post-Translational Modification