LIRB4_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LIRB4_MOUSE
• UniProt AC: Q64281
• Protein Name: Leukocyte immunoglobulin-like receptor subfamily B member 4
• Gene Name: Lilrb4
• Organism: Mus musculus (Mouse).
• Sequence Length: 335
• Subcellular Localization: Cell membrane; Single-pass type I membrane protein. Ligand binding leads to internalization and translocation to an antigen-processing compartment..
• Protein Description: Receptor for class I MHC antigens. Involved in the down-regulation of the immune response and the development of tolerance. Interferes with TNFRSF5-signaling and NF-kappa-B up-regulation. Inhibits receptor-mediated phosphorylation of cellular proteins and mobilization of intracellular calcium ions (By similarity)..
• Protein Sequence: MIAMLTVLLYLGLILEPRTAVQAGHLPKPIIWAEPGSVIAAYTSVITWCQGSWEAQYYHLYKEKSVNPWDTQVPLETRNKAKFNIPSMTTSYAGIYKCYYESAAGFSEHSDAMELVMTGAYENPSLSVYPSSNVTSGVSISFSCSSSIVFGRFILIQEGKHGLSWTLDSQHQANQPSYATFVLDAVTPNHNGTFRCYGYFRNEPQVWSKPSNSLDLMISETKDQSSTPTEDGLETYQKILIGVLVSFLLLFFLLLFLILIGYQYGHKKKANASVKNTQSENNAELNSWNPQNEDPQGIVYAQVKPSRLQKDTACKETQDVTYAQLCIRTQEQNNS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
133	N-linked_Glycosylation	LSVYPSSNVTSGVSI EEEECCCCCCCCCEE	45.48	-
191	N-linked_Glycosylation	DAVTPNHNGTFRCYG EEECCCCCCEEEEEE	58.81	-
277	Phosphorylation	ANASVKNTQSENNAE CCCCCCCCCCCCCCC	27.96	25367039
279	Phosphorylation	ASVKNTQSENNAELN CCCCCCCCCCCCCCC	40.01	25367039
287	Phosphorylation	ENNAELNSWNPQNED CCCCCCCCCCCCCCC	40.63	25159016
300	Phosphorylation	EDPQGIVYAQVKPSR CCCCCEEEEEECHHH	6.87	25159016
306	Phosphorylation	VYAQVKPSRLQKDTA EEEEECHHHCCCCCC	39.65	25367039
317	Phosphorylation	KDTACKETQDVTYAQ CCCCCCCCCCCCHHH	18.63	25159016
321	Phosphorylation	CKETQDVTYAQLCIR CCCCCCCCHHHHHHH	22.79	30635358
322	Phosphorylation	KETQDVTYAQLCIRT CCCCCCCHHHHHHHH	7.69	25159016

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of LIRB4_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of LIRB4_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LIRB4_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PTN6_MOUSE	Ptpn6	physical	9973385

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.