LIP2_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LIP2_ARATH
• UniProt AC: Q67ZU1
• Protein Name: Triacylglycerol lipase 2
• Gene Name: LIP2
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 418
• Subcellular Localization: Secreted .
• Protein Description: Triacylglycerol (TAG) lipase. May be involved for TAG storage breakdown during seed germination (By similarity)..
• Protein Sequence: MAGSVMVPSVSIGLALSVLIFFALSLKTLEARGTFGRLAGQPPQRTAAGGICASSVHIFGYKCEEHDVVTQDGYILNMQRIPEGRAGAVAGDGGKRQPVLIQHGILVDGMSWLLNPADQNLPLILADQGFDVWMGNTRGTRFSRRHKYLNPSQRAFWNWTWDELVSYDLPAMFDHIHGLTGQKIHYLGHSLGTLIGFASFSEKGLVDQVRSAAMLSPVAYLSHMTTVIGDIAAKTFLAEATSILGWPEFNPKSGLVGDFIKAICLKAGIDCYDLVSVITGKNCCLNASTIDLFLANEPQSTSTKNMIHLAQTVRDKELRKYNYGSSDRNIKHYGQAIPPAYNISAIPHELPLFFSYGGLDSLADVKDVEFLLDQFKYHDIDKMNVQFVKDYAHADFIMGVTAKDVVYNQVATFFKRQA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
158	N-linked_Glycosylation	PSQRAFWNWTWDELV HHHCHHCCCCHHHHH	21.61	-
286	N-linked_Glycosylation	TGKNCCLNASTIDLF CCCCCEECHHHHHEE	20.24	-
342	N-linked_Glycosylation	QAIPPAYNISAIPHE CCCCCCCCCCCCCCC	24.68	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of LIP2_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of LIP2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LIP2_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of LIP2_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.