LIN7C_CHICK - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LIN7C_CHICK
• UniProt AC: Q5F425
• Protein Name: Protein lin-7 homolog C
• Gene Name: LIN7C
• Organism: Gallus gallus (Chicken).
• Sequence Length: 197
• Subcellular Localization: Cell membrane; Peripheral membrane protein. Cell junction.
• Protein Description: Plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. Forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains (By similarity)..
• Protein Sequence: MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAVREVYEHVYETVDISSSPEVRANATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYISRIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGKVKLVVRYTPKVLEEMESRFEKMRSAKRRQQN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of LIN7C_CHICK !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of LIN7C_CHICK !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of LIN7C_CHICK !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LIN7C_CHICK !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
KCMA1_CHICK	KCNMA1	physical	22174833

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.