UniProt ID | LICH_HUMAN | |
---|---|---|
UniProt AC | P38571 | |
Protein Name | Lysosomal acid lipase/cholesteryl ester hydrolase | |
Gene Name | LIPA | |
Organism | Homo sapiens (Human). | |
Sequence Length | 399 | |
Subcellular Localization | Lysosome. | |
Protein Description | Crucial for the intracellular hydrolysis of cholesteryl esters and triglycerides that have been internalized via receptor-mediated endocytosis of lipoprotein particles. Important in mediating the effect of LDL (low density lipoprotein) uptake on suppression of hydroxymethylglutaryl-CoA reductase and activation of endogenous cellular cholesteryl ester formation.. | |
Protein Sequence | MKMRFLGLVVCLVLWTLHSEGSGGKLTAVDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDVNILLTQITNLVFHESIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
36 | N-linked_Glycosylation | VDPETNMNVSEIISY ECCCCCCCHHHHHHH | 35.91 | UniProtKB CARBOHYD | |
72 | N-linked_Glycosylation | RIPHGRKNHSDKGPK CCCCCCCCCCCCCCC | 38.24 | UniProtKB CARBOHYD | |
101 | N-linked_Glycosylation | NWVTNLANSSLGFIL HHHHHHHHCCCCEEE | 34.98 | UniProtKB CARBOHYD | |
161 | N-linked_Glycosylation | ASINFILNKTGQEQV EEEEEEECCCCCCEE | 34.72 | 16399764 | |
161 | N-linked_Glycosylation | ASINFILNKTGQEQV EEEEEEECCCCCCEE | 34.72 | 16399764 | |
231 | 2-Hydroxyisobutyrylation | IKDLFGDKEFLPQSA HHHHHCCCCCCCHHH | 51.23 | - | |
231 | Ubiquitination | IKDLFGDKEFLPQSA HHHHHCCCCCCCHHH | 51.23 | - | |
237 | Phosphorylation | DKEFLPQSAFLKWLG CCCCCCHHHHHHHHH | 21.03 | - | |
248 (in isoform 2) | Ubiquitination | - | 1.36 | 21890473 | |
273 | N-linked_Glycosylation | GFNERNLNMSRVDVY CCCCCCCCCCCEEEE | 29.90 | UniProtKB CARBOHYD | |
280 | Phosphorylation | NMSRVDVYTTHSPAG CCCCEEEEECCCCCC | 11.06 | 23532336 | |
289 | Phosphorylation | THSPAGTSVQNMLHW CCCCCCCCHHHHHHH | 22.31 | 23532336 | |
297 | Phosphorylation | VQNMLHWSQAVKFQK HHHHHHHHHHHCCCE | 9.49 | 28674151 | |
304 | Ubiquitination | SQAVKFQKFQAFDWG HHHHCCCEECCCCCC | 42.44 | 2189047 | |
304 (in isoform 1) | Ubiquitination | - | 42.44 | 21890473 | |
317 | Phosphorylation | WGSSAKNYFHYNQSY CCCCCCCCCCCCCCC | 7.33 | - | |
320 | Phosphorylation | SAKNYFHYNQSYPPT CCCCCCCCCCCCCCC | 12.66 | - | |
321 | N-linked_Glycosylation | AKNYFHYNQSYPPTY CCCCCCCCCCCCCCC | 18.76 | 19159218 | |
328 | Phosphorylation | NQSYPPTYNVKDMLV CCCCCCCCCHHCCCC | 24.59 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LICH_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LICH_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LICH_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of LICH_HUMAN !! |
loading...
N-linked Glycosylation | |
Reference | PubMed |
"Glycoproteomics analysis of human liver tissue by combination ofmultiple enzyme digestion and hydrazide chemistry."; Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.; J. Proteome Res. 8:651-661(2009). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-161 AND ASN-321, AND MASSSPECTROMETRY. |