UniProt ID | LHX5_MOUSE | |
---|---|---|
UniProt AC | P61375 | |
Protein Name | LIM/homeobox protein Lhx5 | |
Gene Name | Lhx5 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 402 | |
Subcellular Localization | Nucleus . | |
Protein Description | Plays an essential role in the regulation of neuronal differentiation and migration during development of the central nervous system.. | |
Protein Sequence | MMVHCAGCERPILDRFLLNVLDRAWHIKCVQCCECKTNLSEKCFSREGKLYCKNDFFRRFGTKCAGCAQGISPSDLVRKARSKVFHLNCFTCMVCNKQLSTGEELYVIDENKFVCKDDYLSSSSLKEGSLNSVSSCTDRSLSPDLQDPLQDDPKETDNSTSSDKETANNENEEQNSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHAFFRSPRRMRPLGGRLDESEMLGSTPYTYYGDYQSDYYAPGGNYDFFAHGPPSQAQSPADSSFLAASGPGSTPLGALEPPLAGPHGADNPRFTDMISHPDTPSPEPGLPGALHPMPGEVFSGGPSPPFPMSGTSGYSGPLSHPNPELNEAAVW | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
140 | Phosphorylation | VSSCTDRSLSPDLQD HHHCCCCCCCCCCCC | 35.69 | 28066266 | |
142 | Phosphorylation | SCTDRSLSPDLQDPL HCCCCCCCCCCCCCC | 20.02 | 28066266 | |
188 | Acetylation | RGPRTTIKAKQLETL CCCCCCEEHHHHHHH | 47.65 | 2415207 | |
190 | Acetylation | PRTTIKAKQLETLKA CCCCEEHHHHHHHHH | 50.87 | 2415215 | |
239 | Acetylation | RSKERRMKQLSALGA CCHHHHHHHHHHHHH | 46.40 | 6569539 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LHX5_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LHX5_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LHX5_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of LHX5_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...