UniProt ID | LHPP_HUMAN | |
---|---|---|
UniProt AC | Q9H008 | |
Protein Name | Phospholysine phosphohistidine inorganic pyrophosphate phosphatase | |
Gene Name | LHPP | |
Organism | Homo sapiens (Human). | |
Sequence Length | 270 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | Phosphatase that hydrolyzes imidodiphosphate, 3-phosphohistidine and 6-phospholysine. Has broad substrate specificity and can also hydrolyze inorganic diphosphate, but with lower efficiency (By similarity).. | |
Protein Sequence | MAPWGKRLAGVRGVLLDISGVLYDSGAGGGTAIAGSVEAVARLKRSRLKVRFCTNESQKSRAELVGQLQRLGFDISEQEVTAPAPAACQILKEQGLRPYLLIHDGVRSEFDQIDTSNPNCVVIADAGESFSYQNMNNAFQVLMELEKPVLISLGKGRYYKETSGLMLDVGPYMKALEYACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGMRALQVRTGKFRPSDEHHPEVKADGYVDNLAEAVDLLLQHADK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
19 | Phosphorylation | RGVLLDISGVLYDSG CEEEEEEEEEEEECC | 23.63 | 30257219 | |
59 | Ubiquitination | FCTNESQKSRAELVG ECCCHHHHHHHHHHH | 51.71 | - | |
158 | Phosphorylation | ISLGKGRYYKETSGL EEECCCCCEEECCCC | 27.79 | 28152594 | |
159 | Phosphorylation | SLGKGRYYKETSGLM EECCCCCEEECCCCE | 10.86 | 28152594 | |
162 | Phosphorylation | KGRYYKETSGLMLDV CCCCEEECCCCEEEC | 24.76 | 28152594 | |
163 | Phosphorylation | GRYYKETSGLMLDVG CCCEEECCCCEEECH | 30.90 | 28152594 | |
172 | Phosphorylation | LMLDVGPYMKALEYA CEEECHHHHHHHHHH | 12.81 | 26503514 | |
178 | Phosphorylation | PYMKALEYACGIKAE HHHHHHHHHHCCCCE | 14.19 | 28152594 | |
189 | Ubiquitination | IKAEVVGKPSPEFFK CCCEECCCCCHHHHH | 30.61 | - | |
191 | Phosphorylation | AEVVGKPSPEFFKSA CEECCCCCHHHHHHH | 40.31 | 28857561 | |
241 | Phosphorylation | RTGKFRPSDEHHPEV CCCCCCCCCCCCCCC | 51.91 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LHPP_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LHPP_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LHPP_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of LHPP_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...