UniProt ID | LGUL_MOUSE | |
---|---|---|
UniProt AC | Q9CPU0 | |
Protein Name | Lactoylglutathione lyase | |
Gene Name | Glo1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 184 | |
Subcellular Localization | ||
Protein Description | Catalyzes the conversion of hemimercaptal, formed from methylglyoxal and glutathione, to S-lactoylglutathione. Involved in the regulation of TNF-induced transcriptional activity of NF-kappa-B. Required for normal osteoclastogenesis.. | |
Protein Sequence | MAEPQPASSGLTDETAFSCCSDPDPSTKDFLLQQTMLRIKDPKKSLDFYTRVLGLTLLQKLDFPAMKFSLYFLAYEDKNDIPKDKSEKTAWTFSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKIATII | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAEPQPASS ------CCCCCCCCC | 36.86 | - | |
44 | Acetylation | LRIKDPKKSLDFYTR HHCCCCCHHHHHHHH | 62.73 | 22826441 | |
44 | Malonylation | LRIKDPKKSLDFYTR HHCCCCCHHHHHHHH | 62.73 | 26320211 | |
56 | Phosphorylation | YTRVLGLTLLQKLDF HHHHHHHHHHHHCCC | 24.51 | - | |
60 | Ubiquitination | LGLTLLQKLDFPAMK HHHHHHHHCCCCHHH | 50.41 | - | |
60 | Acetylation | LGLTLLQKLDFPAMK HHHHHHHHCCCCHHH | 50.41 | 22826441 | |
88 | Succinylation | IPKDKSEKTAWTFSR CCCCCCCCCCEEEEE | 51.11 | - | |
88 | Ubiquitination | IPKDKSEKTAWTFSR CCCCCCCCCCEEEEE | 51.11 | - | |
88 | Acetylation | IPKDKSEKTAWTFSR CCCCCCCCCCEEEEE | 51.11 | 23806337 | |
88 | Succinylation | IPKDKSEKTAWTFSR CCCCCCCCCCEEEEE | 51.11 | 23806337 | |
96 | Ubiquitination | TAWTFSRKATLELTH CCEEEEECEEEEEEE | 44.52 | - | |
107 | Phosphorylation | ELTHNWGTEDDETQS EEEECCCCCCCCCHH | 28.05 | - | |
136 | Phosphorylation | GIAVPDVYSACKRFE EEECHHHHHHHHHHH | 9.64 | 17242355 | |
137 | Phosphorylation | IAVPDVYSACKRFEE EECHHHHHHHHHHHH | 27.34 | 29472430 | |
139 | S-nitrosylation | VPDVYSACKRFEELG CHHHHHHHHHHHHHC | 2.39 | 21278135 | |
139 | Glutathionylation | VPDVYSACKRFEELG CHHHHHHHHHHHHHC | 2.39 | 24333276 | |
139 | S-palmitoylation | VPDVYSACKRFEELG CHHHHHHHHHHHHHC | 2.39 | 28526873 | |
139 | S-glutathionyl cysteine | VPDVYSACKRFEELG CHHHHHHHHHHHHHC | 2.39 | - | |
140 | Malonylation | PDVYSACKRFEELGV HHHHHHHHHHHHHCC | 60.89 | 26320211 | |
140 | Ubiquitination | PDVYSACKRFEELGV HHHHHHHHHHHHHCC | 60.89 | - | |
140 | Acetylation | PDVYSACKRFEELGV HHHHHHHHHHHHHCC | 60.89 | 23201123 | |
148 | Ubiquitination | RFEELGVKFVKKPDD HHHHHCCEEEECCCC | 42.51 | - | |
148 | Succinylation | RFEELGVKFVKKPDD HHHHHCCEEEECCCC | 42.51 | 23806337 | |
148 | Succinylation | RFEELGVKFVKKPDD HHHHHCCEEEECCCC | 42.51 | - | |
148 | Malonylation | RFEELGVKFVKKPDD HHHHHCCEEEECCCC | 42.51 | 26320211 | |
148 | Acetylation | RFEELGVKFVKKPDD HHHHHCCEEEECCCC | 42.51 | 22826441 | |
151 | Acetylation | ELGVKFVKKPDDGKM HHCCEEEECCCCCCE | 62.82 | 23201123 | |
152 | Acetylation | LGVKFVKKPDDGKMK HCCEEEECCCCCCEE | 48.67 | 22826441 | |
159 | Acetylation | KPDDGKMKGLAFIQD CCCCCCEEEEEEEEC | 55.01 | 23954790 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LGUL_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
107 | T | Phosphorylation |
| - |
139 | C | Glutathionylation |
| - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LGUL_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of LGUL_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...