LGMN_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LGMN_MOUSE
• UniProt AC: O89017
• Protein Name: Legumain
• Gene Name: Lgmn
• Organism: Mus musculus (Mouse).
• Sequence Length: 435
• Subcellular Localization: Lysosome .
• Protein Description: Has a strict specificity for hydrolysis of asparaginyl bonds. Can also cleave aspartyl bonds slowly, especially under acidic conditions. May be involved in the processing of proteins for MHC class II antigen presentation in the lysosomal/endosomal system. Required for normal lysosomal protein degradation in renal proximal tubules. Required for normal degradation of internalized EGFR. Plays a role in the regulation of cell proliferation via its role in EGFR degradation..
• Protein Sequence: MTWRVAVLLSLVLGAGAVPVGVDDPEDGGKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIIVMMYDDIANSEENPTPGVVINRPNGTDVYKGVLKDYTGEDVTPENFLAVLRGDAEAVKGKGSGKVLKSGPRDHVFIYFTDHGATGILVFPNDDLHVKDLNKTIRYMYEHKMYQKMVFYIEACESGSMMNHLPDDINVYATTAANPKESSYACYYDEERGTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKSISTMKVMQFQGMKHRASSPISLPPVTHLDLTPSPDVPLTILKRKLLRTNDVKESQNLIGQIQQFLDARHVIEKSVHKIVSLLAGFGETAERHLSERTMLTAHDCYQEAVTHFRTHCFNWHSVTYEHALRYLYVLANLCEAPYPIDRIEMAMDKVCLSHY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
52	Glutathionylation	YRHQADACHAYQIIH EHHHHHHCHHHHHHH	1.62	24333276
93	N-linked_Glycosylation	GVVINRPNGTDVYKG CEEEECCCCCCEECC	63.86	-
169	N-linked_Glycosylation	DLHVKDLNKTIRYMY CCCHHCHHHHHHHHH	49.94	-
175	Sulfoxidation	LNKTIRYMYEHKMYQ HHHHHHHHHHCCCHH	1.97	21406390
179	Acetylation	IRYMYEHKMYQKMVF HHHHHHCCCHHHEEH	27.62	22826441
255	Acetylation	LTKETLHKQYHLVKS HHHHHHHHHHCHHHC	56.52	19844875
265	N-linked_Glycosylation	HLVKSHTNTSHVMQY CHHHCCCCCHHHHHC	33.87	-
274	N-linked_Glycosylation	SHVMQYGNKSISTMK HHHHHCCCCCCCHHH	29.93	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of LGMN_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of LGMN_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LGMN_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of LGMN_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.