| UniProt ID | LGI4_HUMAN |  | 
|---|---|---|
| UniProt AC | Q8N135 | |
| Protein Name | Leucine-rich repeat LGI family member 4 | |
| Gene Name | LGI4 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 537 | |
| Subcellular Localization | Secreted . | |
| Protein Description | Component of Schwann cell signaling pathway(s) that controls axon segregation and myelin formation (By similarity).. | |
| Protein Sequence | MGGAGILLLLLAGAGVVVAWRPPKGKCPLRCSCSKDSALCEGSPDLPVSFSPTLLSLSLVRTGVTQLKAGSFLRIPSLHLLLFTSNSFSVIEDDAFAGLSHLQYLFIEDNEIGSISKNALRGLRSLTHLSLANNHLETLPRFLFRGLDTLTHVDLRGNPFQCDCRVLWLLQWMPTVNASVGTGACAGPASLSHMQLHHLDPKTFKCRAIELSWFQTVGESALSVEPFSYQGEPHIVLAQPFAGRCLILSWDYSLQRFRPEEELPAASVVSCKPLVLGPSLFVLAARLWGGSQLWARPSPGLRLAPTQTLAPRRLLRPNDAELLWLEGQPCFVVADASKAGSTTLLCRDGPGFYPHQSLHAWHRDTDAEALELDGRPHLLLASASQRPVLFHWTGGRFERRTDIPEAEDVYATRHFQAGGDVFLCLTRYIGDSMVMRWDGSMFRLLQQLPSRGAHVFQPLLIARDQLAILGSDFAFSQVLRLEPDKGLLEPLQELGPPALVAPRAFAHITMAGRRFLFAACFKGPTQIYQHHEIDLSA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|  | ||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure | ASA (%) | Reference | Orthologous Protein Cluster | 
|---|---|---|---|---|---|
| 58 | Phosphorylation | SPTLLSLSLVRTGVT CHHHHHHHHHHCCCC | 22.80 | 24719451 | |
| 177 | N-linked_Glycosylation | LQWMPTVNASVGTGA HHHCCCCCCCCCCCC | 29.04 | UniProtKB CARBOHYD | |
| 279 | Phosphorylation | KPLVLGPSLFVLAAR CCCCCCHHHHHHHHH | 32.42 | - | |
| 337 | Phosphorylation | CFVVADASKAGSTTL EEEEEEHHHCCCEEE | 24.48 | - | |
| 337 | O-linked_Glycosylation | CFVVADASKAGSTTL EEEEEEHHHCCCEEE | 24.48 | 29351928 | 
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources | 
|---|---|---|---|---|---|---|
| Oops, there are no upstream regulatory protein records of LGI4_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
| Oops, there are no descriptions of PTM sites of LGI4_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) | Residue Change | SAP | Related Disease | Reference | 
|---|---|---|---|---|---|---|
| Oops, there are no SNP-PTM records of LGI4_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions | 
|---|---|---|---|---|
| Oops, there are no PPI records of LGI4_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...