UniProt ID | LGI4_HUMAN | |
---|---|---|
UniProt AC | Q8N135 | |
Protein Name | Leucine-rich repeat LGI family member 4 | |
Gene Name | LGI4 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 537 | |
Subcellular Localization | Secreted . | |
Protein Description | Component of Schwann cell signaling pathway(s) that controls axon segregation and myelin formation (By similarity).. | |
Protein Sequence | MGGAGILLLLLAGAGVVVAWRPPKGKCPLRCSCSKDSALCEGSPDLPVSFSPTLLSLSLVRTGVTQLKAGSFLRIPSLHLLLFTSNSFSVIEDDAFAGLSHLQYLFIEDNEIGSISKNALRGLRSLTHLSLANNHLETLPRFLFRGLDTLTHVDLRGNPFQCDCRVLWLLQWMPTVNASVGTGACAGPASLSHMQLHHLDPKTFKCRAIELSWFQTVGESALSVEPFSYQGEPHIVLAQPFAGRCLILSWDYSLQRFRPEEELPAASVVSCKPLVLGPSLFVLAARLWGGSQLWARPSPGLRLAPTQTLAPRRLLRPNDAELLWLEGQPCFVVADASKAGSTTLLCRDGPGFYPHQSLHAWHRDTDAEALELDGRPHLLLASASQRPVLFHWTGGRFERRTDIPEAEDVYATRHFQAGGDVFLCLTRYIGDSMVMRWDGSMFRLLQQLPSRGAHVFQPLLIARDQLAILGSDFAFSQVLRLEPDKGLLEPLQELGPPALVAPRAFAHITMAGRRFLFAACFKGPTQIYQHHEIDLSA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
58 | Phosphorylation | SPTLLSLSLVRTGVT CHHHHHHHHHHCCCC | 22.80 | 24719451 | |
177 | N-linked_Glycosylation | LQWMPTVNASVGTGA HHHCCCCCCCCCCCC | 29.04 | UniProtKB CARBOHYD | |
279 | Phosphorylation | KPLVLGPSLFVLAAR CCCCCCHHHHHHHHH | 32.42 | - | |
337 | Phosphorylation | CFVVADASKAGSTTL EEEEEEHHHCCCEEE | 24.48 | - | |
337 | O-linked_Glycosylation | CFVVADASKAGSTTL EEEEEEHHHCCCEEE | 24.48 | 29351928 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LGI4_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LGI4_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LGI4_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of LGI4_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...