LGI1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LGI1_MOUSE
• UniProt AC: Q9JIA1
• Protein Name: Leucine-rich glioma-inactivated protein 1
• Gene Name: Lgi1
• Organism: Mus musculus (Mouse).
• Sequence Length: 557
• Subcellular Localization: Secreted . Cell junction, synapse. Isoform 1 and isoform 2 are detected in the cytosolic and microsomal fractions respectively.
• Protein Description: Regulates voltage-gated potassium channels assembled from KCNA1, KCNA4 and KCNAB1. It slows down channel inactivation by precluding channel closure mediated by the KCNAB1 subunit. Ligand for ADAM22 that positively regulates synaptic transmission mediated by AMPA-type glutamate receptors. Plays a role in suppressing the production of MMP1/3 through the phosphatidylinositol 3-kinase/ERK pathway (By similarity)..
• Protein Sequence: MESESSRRMGNACIPLKRIAYFLCLFSVVLLTEGKKPAKPKCPAVCTCSKDNALCENARSIPRTVPPDVISLSFVRSGFTEISEGSFLFTPSLQLLLFTSNSFDVISDDAFIGLPHLEYLFIENNNIKSISRHTFRGLKSLIHLSLANNNLQTLPKDIFKGLDSLTNVDLRGNAFNCDCKLKWLVEWLGHTNATVEDIYCEGPPEYKKRKINSLSPKDFDCIITEFAKSQDLPYQSLSIDTFSYLNDEYVVIAQPFTGKCIFLEWDHVEKTFRNYDNITGTSTVVCKPIVIDTQLYVIVAQLFGGSHIYKRDGFANKFIKIQDIEVLKIRKPNDIETFKIEDNWYFVVADSSKAGFTTIYKWNGNGFYSHQSLHAWYRDTDVEYLEIARPPLALRTPHLILSSSSQRPVIYQWSKATQLFTNQTDIPNMEDVYAVKHFSVKGDVYICLTRFIGDSKVMKWGGSSFQDIQRMPSRGSMVFQPLQINNYQYAILGSDYSFTQVYNWDAEKAKFVKFQELNVQAPRSFTHVSINKRNFLFASSFKGNTQIYKHVIVDLSA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
192	N-linked_Glycosylation	VEWLGHTNATVEDIY HHHHCCCCCCHHHCC	28.12	-
277	N-linked_Glycosylation	KTFRNYDNITGTSTV HHCCCCCCCCCCCEE	24.30	-
422	N-linked_Glycosylation	KATQLFTNQTDIPNM HHHHHHCCCCCCCCH	35.11	-
470	Methylation	SSFQDIQRMPSRGSM CCHHHHHHCCCCCCE	39.04	16289459

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of LGI1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of LGI1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LGI1_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of LGI1_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.