UniProt ID | LFG2_HUMAN | |
---|---|---|
UniProt AC | Q9BWQ8 | |
Protein Name | Protein lifeguard 2 | |
Gene Name | FAIM2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 316 | |
Subcellular Localization |
Cell membrane Multi-pass membrane protein. Membrane raft . Cell junction, synapse, postsynaptic cell membrane. |
|
Protein Description | Antiapoptotic protein which protects cells uniquely from Fas-induced apoptosis. Regulates Fas-mediated apoptosis in neurons by interfering with caspase-8 activation. May play a role in cerebellar development by affecting cerebellar size, internal granular layer (IGL) thickness, and Purkinje cell (PC) development.. | |
Protein Sequence | MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVDPSSSSSYDNGFPTGDHELFTTFSWDDQKVRRVFVRKVYTILLIQLLVTLAVVALFTFCDPVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTVFTLSMAYLTGMLSSYYNTTSVLLCLGITALVCLSVTVFSFQTKFDFTSCQGVLFVLLMTLFFSGLILAILLPFQYVPWLHAVYAALGAGVFTLFLALDTQLLMGNRRHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTNRE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Ubiquitination | ---MTQGKLSVANKA ---CCCCCCCCCCCC | 27.98 | 30230243 | |
11 | Acetylation | GKLSVANKAPGTEGQ CCCCCCCCCCCCCCC | 46.34 | 7964571 | |
11 | Ubiquitination | GKLSVANKAPGTEGQ CCCCCCCCCCCCCCC | 46.34 | 32142685 | |
25 | Ubiquitination | QQQVHGEKKEAPAVP CCCCCCCCCCCCCCC | 61.58 | 30230243 | |
26 | Ubiquitination | QQVHGEKKEAPAVPS CCCCCCCCCCCCCCC | 55.60 | 30230243 | |
33 | Phosphorylation | KEAPAVPSAPPSYEE CCCCCCCCCCCCCCC | 46.97 | - | |
38 | Phosphorylation | VPSAPPSYEEATSGE CCCCCCCCCCCCCCC | 24.46 | 25884760 | |
42 | Phosphorylation | PPSYEEATSGEGMKA CCCCCCCCCCCCCCC | 40.31 | - | |
43 | Phosphorylation | PSYEEATSGEGMKAG CCCCCCCCCCCCCCC | 41.73 | 19690332 | |
191 | N-linked_Glycosylation | GMLSSYYNTTSVLLC HHHHHHCCHHHHHHH | 28.75 | UniProtKB CARBOHYD |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LFG2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LFG2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LFG2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TNR6_HUMAN | FAS | physical | 10535980 | |
RO52_HUMAN | TRIM21 | physical | 26398169 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...