| UniProt ID | LCOR_MOUSE | |
|---|---|---|
| UniProt AC | Q6ZPI3 | |
| Protein Name | Ligand-dependent corepressor | |
| Gene Name | Lcor | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 433 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Repressor of ligand-dependent transcription activation by various nuclear repressors. Repressor of ligand-dependent transcription activation by ESR1, ESR2, NR3C1, PGR, RARA, RARB, RARG, RXRA and VDR (By similarity). May act as transcription activator that binds DNA elements with the sequence 5'-CCCTATCGATCGATCTCTACCT-3'.. | |
| Protein Sequence | MQRMIQQFAAEYTSKTSSTQDPSQPNSTKNQSLPKASPVTTSPTAATTQNPVLSKLLMADQDSPLDLTVRKSQSEPSEQDGVLDLSTKKSPCASSTSLSHSPGCSSTQGNGRPGRPSQYRPDGLRSGDGVPPRSLQDGTREGFGHSTSLKVPLARSLQISEELLSRNQLSTAASLGPSGLQNHGQHLILSREASWAKPHYEFSLSRMKFRGNGALSNISDLPFLAENSAFPKMAHQTKQDGKRDMSHSSPVDLKIPQVRGMDLSWESRTGDQYSYSSLVMGSQTESALSKKLRAILPKQNRKSMLDAGPDSWGSDAEQSTSGQPYPTSDQEGDPGSKQPRKKRGRYRQYNSEILEEAISVVMSGKMSVSKAQSIYGIPHSTLEYKVKERLGTLKNPPKKKMKLMRSEGPDVSVKIELDPQGEAAQSANESKTE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 37 | Phosphorylation | NQSLPKASPVTTSPT CCCCCCCCCCCCCCC | 26.48 | 26239621 | |
| 40 | Phosphorylation | LPKASPVTTSPTAAT CCCCCCCCCCCCCCC | 25.58 | 26239621 | |
| 41 | Phosphorylation | PKASPVTTSPTAATT CCCCCCCCCCCCCCC | 32.70 | 26239621 | |
| 42 | Phosphorylation | KASPVTTSPTAATTQ CCCCCCCCCCCCCCC | 15.76 | 22942356 | |
| 44 | Phosphorylation | SPVTTSPTAATTQNP CCCCCCCCCCCCCCH | 28.79 | 26239621 | |
| 47 | Phosphorylation | TTSPTAATTQNPVLS CCCCCCCCCCCHHHH | 26.84 | 28833060 | |
| 48 | Phosphorylation | TSPTAATTQNPVLSK CCCCCCCCCCHHHHH | 22.94 | 28833060 | |
| 54 | Phosphorylation | TTQNPVLSKLLMADQ CCCCHHHHHHHHCCC | 22.84 | 28833060 | |
| 63 | Phosphorylation | LLMADQDSPLDLTVR HHHCCCCCCCCEEEE | 23.02 | - | |
| 248 | Phosphorylation | GKRDMSHSSPVDLKI CCCCCCCCCCCCCCC | 29.09 | 28066266 | |
| 249 | Phosphorylation | KRDMSHSSPVDLKIP CCCCCCCCCCCCCCC | 24.42 | 28066266 | |
| 303 | Phosphorylation | LPKQNRKSMLDAGPD CCCCCHHHHHHCCCC | 22.72 | 27087446 | |
| 328 | Phosphorylation | SGQPYPTSDQEGDPG CCCCCCCCCCCCCCC | 32.56 | 27087446 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LCOR_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LCOR_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LCOR_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of LCOR_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
