UniProt ID | LCOR_MOUSE | |
---|---|---|
UniProt AC | Q6ZPI3 | |
Protein Name | Ligand-dependent corepressor | |
Gene Name | Lcor | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 433 | |
Subcellular Localization | Nucleus . | |
Protein Description | Repressor of ligand-dependent transcription activation by various nuclear repressors. Repressor of ligand-dependent transcription activation by ESR1, ESR2, NR3C1, PGR, RARA, RARB, RARG, RXRA and VDR (By similarity). May act as transcription activator that binds DNA elements with the sequence 5'-CCCTATCGATCGATCTCTACCT-3'.. | |
Protein Sequence | MQRMIQQFAAEYTSKTSSTQDPSQPNSTKNQSLPKASPVTTSPTAATTQNPVLSKLLMADQDSPLDLTVRKSQSEPSEQDGVLDLSTKKSPCASSTSLSHSPGCSSTQGNGRPGRPSQYRPDGLRSGDGVPPRSLQDGTREGFGHSTSLKVPLARSLQISEELLSRNQLSTAASLGPSGLQNHGQHLILSREASWAKPHYEFSLSRMKFRGNGALSNISDLPFLAENSAFPKMAHQTKQDGKRDMSHSSPVDLKIPQVRGMDLSWESRTGDQYSYSSLVMGSQTESALSKKLRAILPKQNRKSMLDAGPDSWGSDAEQSTSGQPYPTSDQEGDPGSKQPRKKRGRYRQYNSEILEEAISVVMSGKMSVSKAQSIYGIPHSTLEYKVKERLGTLKNPPKKKMKLMRSEGPDVSVKIELDPQGEAAQSANESKTE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
37 | Phosphorylation | NQSLPKASPVTTSPT CCCCCCCCCCCCCCC | 26.48 | 26239621 | |
40 | Phosphorylation | LPKASPVTTSPTAAT CCCCCCCCCCCCCCC | 25.58 | 26239621 | |
41 | Phosphorylation | PKASPVTTSPTAATT CCCCCCCCCCCCCCC | 32.70 | 26239621 | |
42 | Phosphorylation | KASPVTTSPTAATTQ CCCCCCCCCCCCCCC | 15.76 | 22942356 | |
44 | Phosphorylation | SPVTTSPTAATTQNP CCCCCCCCCCCCCCH | 28.79 | 26239621 | |
47 | Phosphorylation | TTSPTAATTQNPVLS CCCCCCCCCCCHHHH | 26.84 | 28833060 | |
48 | Phosphorylation | TSPTAATTQNPVLSK CCCCCCCCCCHHHHH | 22.94 | 28833060 | |
54 | Phosphorylation | TTQNPVLSKLLMADQ CCCCHHHHHHHHCCC | 22.84 | 28833060 | |
63 | Phosphorylation | LLMADQDSPLDLTVR HHHCCCCCCCCEEEE | 23.02 | - | |
248 | Phosphorylation | GKRDMSHSSPVDLKI CCCCCCCCCCCCCCC | 29.09 | 28066266 | |
249 | Phosphorylation | KRDMSHSSPVDLKIP CCCCCCCCCCCCCCC | 24.42 | 28066266 | |
303 | Phosphorylation | LPKQNRKSMLDAGPD CCCCCHHHHHHCCCC | 22.72 | 27087446 | |
328 | Phosphorylation | SGQPYPTSDQEGDPG CCCCCCCCCCCCCCC | 32.56 | 27087446 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LCOR_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LCOR_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LCOR_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of LCOR_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...