dbPTM

LCB2_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	LCB2_SCHPO
UniProt AC	Q09925
Protein Name	Serine palmitoyltransferase 2
Gene Name	lcb2
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	603
Subcellular Localization	Cytoplasm. Endoplasmic reticulum . Membrane Single-pass membrane protein .
Protein Description	Catalytic subunit of serine palmitoyltransferase (SPT), which catalyzes the committed step in the synthesis of sphingolipids, the condensation of serine with palmitoyl CoA to form the long chain base 3-ketosphinganine..
Protein Sequence	MAQADFVSPTSIDVSEKKEVEFHKKVDHVENPPLSTESAKLEAEEVAAEKLNSEHLLENEFAPITDPTHRRVSKNPDGAELFQFEDEPSYYYVVATYLTYLVLIIIGHVRDFFGKRFHKDDYKYLKDNDGYAPLYNHFDNFYVRRLQHRINDCFSRPTMGVPGRVIRLMNRYSTDSNSTFKLTGDTSLALNVSSYNYLGFAQSHGPCATKVEEAMQKYGLSTCSSNAICGTYGLHKEVEELTANFVGKPAALVFSQGFSTNATVFSTLMCPGSLIISDELNHTSIRFGARLSGANIRVYKHNDMTDLERVLREVISQGQPRTHRPYSKILVVIEGLYSMEGNFCDLPKVVELKNRYKFYLFIDEAHSIGAIGPRGGGICDYFGISTDHVDILMGTFTKSFGAAGGYISATPNIINKLRVTNPGYVYAESMSPAVLAQIKSSFLEIMDNSPTSAGLERIERLAFNSRYIRLGLKRLGFIIFGNDDSPVVPLLLYNPGKINAFSHEMLKRGIAVVVVGYPACPLLTSRVRFCFSASHNKADMDYFLRACDEVGEKLQLKFSTGAAGEDVGKTNVEKMKKNQGWFKPPRWKIEDVLKHGVHDALTQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
35	Phosphorylation	HVENPPLSTESAKLE CCCCCCCCHHHHHHH	35.58	24763107
36	Phosphorylation	VENPPLSTESAKLEA CCCCCCCHHHHHHHH	41.46	24763107
38	Phosphorylation	NPPLSTESAKLEAEE CCCCCHHHHHHHHHH	30.69	21712547
398	N6-(pyridoxal phosphate)lysine	ILMGTFTKSFGAAGG EEEHHCCCCCCCCCC	39.33	-
398	Other	ILMGTFTKSFGAAGG EEEHHCCCCCCCCCC	39.33	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of LCB2_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of LCB2_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of LCB2_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of LCB2_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of LCB2_SCHPO

Related Literatures of Post-Translational Modification