LCAT2_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LCAT2_ARATH
• UniProt AC: Q4VCM1
• Protein Name: Phospholipid--sterol O-acyltransferase
• Gene Name: PSAT
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 633
• Subcellular Localization: Microsome membrane ; Single-pass type II membrane protein .
• Protein Description: Involved in lipid catabolism. Essential for sterol esters biosynthesis in leaves and seeds, but not in flowers. Plays a role in controlling the free sterol content of leaves. Catalyzes the transacylation of acyl groups from phospholipids to a variety of different sterols. Prefers phosphatidylethanolamine over phosphatidylcholine as an acyl donor. Not active toward neutral lipids. Highly specific for position sn-2, which in plant lipids is essentially devoid of saturated acyl groups. Broad sterol specificity (cholesterol > campesterol > sitosterol > stigmasterol), but no activity with lupeol or beta-amyrin..
• Protein Sequence: MGANSKSVTASFTVIAVFFLICGGRTAVEDETEFHGDYSKLSGIIIPGFASTQLRAWSILDCPYTPLDFNPLDLVWLDTTKLLSAVNCWFKCMVLDPYNQTDHPECKSRPDSGLSAITELDPGYITGPLSTVWKEWLKWCVEFGIEANAIVAVPYDWRLSPTKLEERDLYFHKLKLTFETALKLRGGPSIVFAHSMGNNVFRYFLEWLRLEIAPKHYLKWLDQHIHAYFAVGAPLLGSVEAIKSTLSGVTFGLPVSEGTARLLSNSFASSLWLMPFSKNCKGDNTFWTHFSGGAAKKDKRVYHCDEEEYQSKYSGWPTNIINIEIPSTSVTETALVNMTSMECGLPTLLSFTARELADGTLFKAIEDYDPDSKRMLHQLKKLYHDDPVFNPLTPWERPPIKNVFCIYGAHLKTEVGYYFAPSGKPYPDNWIITDIIYETEGSLVSRSGTVVDGNAGPITGDETVPYHSLSWCKNWLGPKVNITMAPQPEHDGSDVHVELNVDHEHGSDIIANMTKAPRVKYITFYEDSESIPGKRTAVWELDKTNHRNIVRSPVLMRELWLQMWHDIQPGAKSKFVTKAKRGPLRDADCYWDYGKACCAWQEYCEYRYSFGDVHLGQSCRLRNTSANMLLQYI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
177	Phosphorylation	YFHKLKLTFETALKL EEEECEEEHHHHHHH	20.17	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of LCAT2_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of LCAT2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LCAT2_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of LCAT2_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.