UniProt ID | LCAT2_ARATH | |
---|---|---|
UniProt AC | Q4VCM1 | |
Protein Name | Phospholipid--sterol O-acyltransferase | |
Gene Name | PSAT | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 633 | |
Subcellular Localization |
Microsome membrane Single-pass type II membrane protein . |
|
Protein Description | Involved in lipid catabolism. Essential for sterol esters biosynthesis in leaves and seeds, but not in flowers. Plays a role in controlling the free sterol content of leaves. Catalyzes the transacylation of acyl groups from phospholipids to a variety of different sterols. Prefers phosphatidylethanolamine over phosphatidylcholine as an acyl donor. Not active toward neutral lipids. Highly specific for position sn-2, which in plant lipids is essentially devoid of saturated acyl groups. Broad sterol specificity (cholesterol > campesterol > sitosterol > stigmasterol), but no activity with lupeol or beta-amyrin.. | |
Protein Sequence | MGANSKSVTASFTVIAVFFLICGGRTAVEDETEFHGDYSKLSGIIIPGFASTQLRAWSILDCPYTPLDFNPLDLVWLDTTKLLSAVNCWFKCMVLDPYNQTDHPECKSRPDSGLSAITELDPGYITGPLSTVWKEWLKWCVEFGIEANAIVAVPYDWRLSPTKLEERDLYFHKLKLTFETALKLRGGPSIVFAHSMGNNVFRYFLEWLRLEIAPKHYLKWLDQHIHAYFAVGAPLLGSVEAIKSTLSGVTFGLPVSEGTARLLSNSFASSLWLMPFSKNCKGDNTFWTHFSGGAAKKDKRVYHCDEEEYQSKYSGWPTNIINIEIPSTSVTETALVNMTSMECGLPTLLSFTARELADGTLFKAIEDYDPDSKRMLHQLKKLYHDDPVFNPLTPWERPPIKNVFCIYGAHLKTEVGYYFAPSGKPYPDNWIITDIIYETEGSLVSRSGTVVDGNAGPITGDETVPYHSLSWCKNWLGPKVNITMAPQPEHDGSDVHVELNVDHEHGSDIIANMTKAPRVKYITFYEDSESIPGKRTAVWELDKTNHRNIVRSPVLMRELWLQMWHDIQPGAKSKFVTKAKRGPLRDADCYWDYGKACCAWQEYCEYRYSFGDVHLGQSCRLRNTSANMLLQYI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
177 | Phosphorylation | YFHKLKLTFETALKL EEEECEEEHHHHHHH | 20.17 | 19880383 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LCAT2_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LCAT2_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LCAT2_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of LCAT2_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...