LBX1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LBX1_HUMAN
• UniProt AC: P52954
• Protein Name: Transcription factor LBX1
• Gene Name: LBX1
• Organism: Homo sapiens (Human).
• Sequence Length: 281
• Subcellular Localization: Nucleus .
• Protein Description: Transcription factor required for the development of GABAergic interneurons in the dorsal horn of the spinal cord and migration and further development of hypaxial muscle precursor cells for limb muscles, diaphragm and hypoglossal cord..
• Protein Sequence: MTSKEDGKAAPGEERRRSPLDHLPPPANSNKPLTPFSIEDILNKPSVRRSYSLCGAAHLLAAADKHAQGGLPLAGRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGRDGMTIFGQRQTPKKRRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMKADVESAKKLGPSGQMDIVALAELEQNSEATAGGGGGCGRAKSRPGSPVLPPGAPKAPGAGALQLSPASPLTDQPASSQDCSEDEEDEEIDVDD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
50	Phosphorylation	NKPSVRRSYSLCGAA CCCCHHHHHHHHHHH	14.44	27251275
52	Phosphorylation	PSVRRSYSLCGAAHL CCHHHHHHHHHHHHH	20.59	27251275
230	Phosphorylation	GGCGRAKSRPGSPVL CCCCCCCCCCCCCCC	42.60	26437602
234	Phosphorylation	RAKSRPGSPVLPPGA CCCCCCCCCCCCCCC	17.96	26437602

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of LBX1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of LBX1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LBX1_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of LBX1_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.