| UniProt ID | LBD1_ARATH | |
|---|---|---|
| UniProt AC | Q9LQR0 | |
| Protein Name | LOB domain-containing protein 1 | |
| Gene Name | LBD1 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 190 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MESKSDASVATTPIISSSSSPPPSLSPRVVLSPCAACKILRRRCAERCVLAPYFPPTDPAKFTIAHRVFGASNIIKFLQELPESQRTDAVNSMVYEAEARIRDPVYGCAGAIYHLQRQVSELQAQLAKAQVEMVNMQFQRSNLLELIYNMDQQQKQEQDNMSFESNDLGFLEDKSNTNSSMLWWDPLWTC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 5 | Phosphorylation | ---MESKSDASVATT ---CCCCCCCCCCCC | 47.92 | 28295753 | |
| 8 | Phosphorylation | MESKSDASVATTPII CCCCCCCCCCCCCCC | 19.78 | 28295753 | |
| 11 | Phosphorylation | KSDASVATTPIISSS CCCCCCCCCCCCCCC | 30.83 | 28295753 | |
| 12 | Phosphorylation | SDASVATTPIISSSS CCCCCCCCCCCCCCC | 11.62 | 28295753 | |
| 16 | Phosphorylation | VATTPIISSSSSPPP CCCCCCCCCCCCCCC | 25.53 | 28295753 | |
| 17 | Phosphorylation | ATTPIISSSSSPPPS CCCCCCCCCCCCCCC | 24.67 | 28295753 | |
| 18 | Phosphorylation | TTPIISSSSSPPPSL CCCCCCCCCCCCCCC | 28.22 | 28295753 | |
| 19 | Phosphorylation | TPIISSSSSPPPSLS CCCCCCCCCCCCCCC | 49.14 | 28295753 | |
| 20 | Phosphorylation | PIISSSSSPPPSLSP CCCCCCCCCCCCCCC | 43.29 | 28295753 | |
| 24 | Phosphorylation | SSSSPPPSLSPRVVL CCCCCCCCCCCCEEE | 47.45 | 28295753 | |
| 26 | Phosphorylation | SSPPPSLSPRVVLSP CCCCCCCCCCEEECH | 18.26 | 28295753 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LBD1_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LBD1_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LBD1_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of LBD1_ARATH !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
