LAT_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LAT_MOUSE
• UniProt AC: O54957
• Protein Name: Linker for activation of T-cells family member 1
• Gene Name: Lat
• Organism: Mus musculus (Mouse).
• Sequence Length: 242
• Subcellular Localization: Cell membrane; Single-pass type III membrane protein. Present in lipid rafts.
• Protein Description: Required for TCR (T-cell antigen receptor)- and pre-TCR-mediated signaling, both in mature T-cells and during their development. Involved in FCGR3 (low affinity immunoglobulin gamma Fc region receptor III)-mediated signaling in natural killer cells and FCER1 (high affinity immunoglobulin epsilon receptor)-mediated signaling in mast cells. Couples activation of these receptors and their associated kinases with distal intracellular events such as mobilization of intracellular calcium stores, PKC activation, MAPK activation or cytoskeletal reorganization through the recruitment of PLCG1, GRB2, GRAP2, and other signaling molecules..
• Protein Sequence: MEADALSPVGLGLLLLPFLVTLLAALCVRCRELPVSYDSTSTESLYPRSILIKPPQITVPRTPAVSYPLVTSFPPLRQPDLLPIPRSPQPLGGSHRMPSSQQNSDDANSVASYENQEPACKNVDADEDEDDYPNGYLVVLPDSSPAAVPVVSSAPVPSNPDLGDSAFSVESCEDYVNVPESEESAEASLDGSREYVNVSPEQQPVTRAELASVNSQEVEDEGEEEGVDGEEAPDYENLQELN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
27	S-palmitoylation	VTLLAALCVRCRELP HHHHHHHHHHHCCCC	1.23	19592663
30	S-palmitoylation	LAALCVRCRELPVSY HHHHHHHHCCCCCCC	1.65	19592663
36	Phosphorylation	RCRELPVSYDSTSTE HHCCCCCCCCCCCCC	22.68	28833060
37	Phosphorylation	CRELPVSYDSTSTES HCCCCCCCCCCCCCC	17.72	28833060
39	Phosphorylation	ELPVSYDSTSTESLY CCCCCCCCCCCCCCC	18.94	28833060
40	Phosphorylation	LPVSYDSTSTESLYP CCCCCCCCCCCCCCC	36.45	28833060
41	Phosphorylation	PVSYDSTSTESLYPR CCCCCCCCCCCCCCC	33.84	28833060
42	Phosphorylation	VSYDSTSTESLYPRS CCCCCCCCCCCCCCE	29.67	28833060
44	Phosphorylation	YDSTSTESLYPRSIL CCCCCCCCCCCCEEE	33.04	28833060
46	Phosphorylation	STSTESLYPRSILIK CCCCCCCCCCEEEEC	13.09	28833060
49	Phosphorylation	TESLYPRSILIKPPQ CCCCCCCEEEECCCC	19.76	27600695
87	Phosphorylation	DLLPIPRSPQPLGGS CCCCCCCCCCCCCCC	23.64	28833060
94	Phosphorylation	SPQPLGGSHRMPSSQ CCCCCCCCCCCCCCC	13.21	28833060
104	Phosphorylation	MPSSQQNSDDANSVA CCCCCCCCCCHHHHH	32.31	21082442
109	Phosphorylation	QNSDDANSVASYENQ CCCCCHHHHHHHHCC	22.30	28833060
112	Phosphorylation	DDANSVASYENQEPA CCHHHHHHHHCCCCC	30.72	28833060
113	Phosphorylation	DANSVASYENQEPAC CHHHHHHHHCCCCCC	14.79	28833060
136	Phosphorylation	EDDYPNGYLVVLPDS CCCCCCCEEEECCCC	11.72	21149602
175	Phosphorylation	SVESCEDYVNVPESE CCCCHHHHCCCCCCH	3.30	19917692
195	Phosphorylation	SLDGSREYVNVSPEQ HCCCCCCCCCCCHHC	9.01	18261158
199	Phosphorylation	SREYVNVSPEQQPVT CCCCCCCCHHCCCCC	19.95	21082442
206	Phosphorylation	SPEQQPVTRAELASV CHHCCCCCHHHHHHC	30.74	28833060
212	Phosphorylation	VTRAELASVNSQEVE CCHHHHHHCCCEECC	34.16	22817900
215	Phosphorylation	AELASVNSQEVEDEG HHHHHCCCEECCCCC	26.09	22817900
235	Phosphorylation	DGEEAPDYENLQELN CCCCCCCHHHHHHCC	12.98	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
136	Y	Phosphorylation	Kinase	ZAP70	P43404	PSP
175	Y	Phosphorylation	Kinase	ZAP70	P43404	PSP
195	Y	Phosphorylation	Kinase	ZAP70	P43404	PSP
235	Y	Phosphorylation	Kinase	ZAP70	P43404	PSP

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
27	C	Palmitoylation	Palmitoylation of Cys-27 and Cys-30 is required for raft targeting and efficient phosphorylation.	-
27	C	Phosphorylation	Palmitoylation of Cys-27 and Cys-30 is required for raft targeting and efficient phosphorylation.	-
30	C	Palmitoylation	Palmitoylation of Cys-27 and Cys-30 is required for raft targeting and efficient phosphorylation.	-
30	C	Phosphorylation	Palmitoylation of Cys-27 and Cys-30 is required for raft targeting and efficient phosphorylation.	-

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LAT_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of LAT_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Palmitoylation

"Palmitoylation-dependent plasma membrane transport but lipid raft-independent signaling by linker for activation of T cells.";
Hundt M., Harada Y., De Giorgio L., Tanimura N., Zhang W., Altman A.;
J. Immunol. 183:1685-1694(2009).
Cited for: PALMITOYLATION AT CYS-27 AND CYS-30.
PubMed: 19592663

"Glucocorticoids alter the lipid and protein composition of membranerafts of a murine T cell hybridoma.";
Van Laethem F., Liang X., Andris F., Urbain J., Vandenbranden M.,Ruysschaert J.-M., Resh M.D., Stulnig T.M., Leo O.;
J. Immunol. 170:2932-2939(2003).
Cited for: PALMITOYLATION.
PubMed: 12626544