LAT2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LAT2_MOUSE
• UniProt AC: Q9QXW9
• Protein Name: Large neutral amino acids transporter small subunit 2
• Gene Name: Slc7a8
• Organism: Mus musculus (Mouse).
• Sequence Length: 531
• Subcellular Localization: Cytoplasm. Basolateral cell membrane ; Multi-pass membrane protein . Localized to the cytoplasm when expressed alone (By similarity). When coexpressed with SLC3A2/4F2hc, is localized to the plasma membrane. Colocalized with SLC3A2/4F2hc at the basola
• Protein Description: Sodium-independent, high-affinity transport of small and large neutral amino acids such as alanine, serine, threonine, cysteine, phenylalanine, tyrosine, leucine, arginine and tryptophan, when associated with SLC3A2/4F2hc. Acts as an amino acid exchanger. Has higher affinity for L-phenylalanine than LAT1 but lower affinity for glutamine and serine. L-alanine is transported at physiological concentrations. Plays a role in basolateral (re)absorption of neutral amino acids. Involved in the uptake of methylmercury (MeHg) when administered as the L-cysteine or D,L-homocysteine complexes, and hence plays a role in metal ion homeostasis and toxicity. Involved in the cellular activity of small molecular weight nitrosothiols, via the stereoselective transport of L-nitrosocysteine (L-CNSO) across the transmembrane. Plays an essential role in the reabsorption of neutral amino acids from the epithelial cells to the bloodstream in the kidney..
• Protein Sequence: MEKGARQRNNTAKNHPGSDTSPEAEASSGGGGVALKKEIGLVSACGIIVGNIIGSGIFVSPKGVLENAGSVGLALIVWIVTGIITAVGALCYAELGVTIPKSGGDYSYVKDIFGGLAGFLRLWIAVLVIYPTNQAVIALTFSNYVLQPLFPTCFPPESGLRLLAAICLLLLTWVNCSSVRWATRVQDIFTAGKLLALALIIIMGIVQICKGEFFWLEPKNAFENFQEPDIGLVALAFLQGSFAYGGWNFLNYVTEELVDPYKNLPRAIFISIPLVTFVYVFANIAYVTAMSPQELLASNAVAVTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLPSVLAMIHVKRCTPIPALLFTCLSTLLMLVTSDMYTLINYVGFINYLFYGVTVAGQIVLRWKKPDIPRPIKVSLLFPIIYLLFWAFLLIFSLWSEPVVCGIGLAIMLTGVPVYFLGVYWQHKPKCFNDFIKSLTLVSQKMCVVVYPQEGNSGAEETTDDLEEQHKPIFKPTPVKDPDSEEQP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
11	Phosphorylation	GARQRNNTAKNHPGS HHHHCCCCCCCCCCC	42.42	-
18	Phosphorylation	TAKNHPGSDTSPEAE CCCCCCCCCCCCCHH	42.01	25521595
20	Phosphorylation	KNHPGSDTSPEAEAS CCCCCCCCCCCHHHH	48.13	25521595
21	Phosphorylation	NHPGSDTSPEAEASS CCCCCCCCCCHHHHC	26.23	25521595
27	Phosphorylation	TSPEAEASSGGGGVA CCCCHHHHCCCCCHH	22.48	25521595
28	Phosphorylation	SPEAEASSGGGGVAL CCCHHHHCCCCCHHC	48.80	24925903
295	Ubiquitination	TAMSPQELLASNAVA HCCCHHHHHHCCCEE	4.00	27667366
316	Ubiquitination	LLGVMAWIMPISVAL HHHHHHHHHHHHHHH	1.38	27667366
500	Phosphorylation	VYPQEGNSGAEETTD EECCCCCCCCCCCCC	50.68	25195567
505	Phosphorylation	GNSGAEETTDDLEEQ CCCCCCCCCCCHHHH	27.34	22817900
506	Phosphorylation	NSGAEETTDDLEEQH CCCCCCCCCCHHHHC	30.69	19060867
518	Ubiquitination	EQHKPIFKPTPVKDP HHCCCCCCCCCCCCC	49.02	27667366
520	Phosphorylation	HKPIFKPTPVKDPDS CCCCCCCCCCCCCCC	41.10	22817900
527	Phosphorylation	TPVKDPDSEEQP--- CCCCCCCCCCCC---	48.71	25521595

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of LAT2_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of LAT2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LAT2_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
4F2_HUMAN	SLC3A2	physical	10574970

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.