LAP4A_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LAP4A_RAT
• UniProt AC: Q6P501
• Protein Name: Lysosomal-associated transmembrane protein 4A
• Gene Name: Laptm4a
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 233
• Subcellular Localization: Endomembrane system ; Multi-pass membrane protein . May reside in an intracellular membrane-bound compartment.
• Protein Description: May function in the transport of nucleosides and/or nucleoside derivatives between the cytosol and the lumen of an intracellular membrane-bound compartment..
• Protein Sequence: MVSMTFKRSRSDRFYSTRCCGCCHVRTGTIILGTWYMVVNLLMAILLTVEVTHPNSMPAVNIQYEVIGNYYSSERMADNACVLFAVSVLMFIISSMLVYGAISYQVGWLIPFFCYRLFDFVLSCLVAISSLTYLPRIKEYLDQLPDFPYKDDLLALDSSCLLFIVLVFFVVFIIFKAYLINCVWNCYKYINNRNVPEIAVYPAFEAPPQYVLPTYEMAVKIPEKEPPPPYLPA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MVSMTFKR -------CCCCEEEC	4.55	-
224	Ubiquitination	MAVKIPEKEPPPPYL EEEECCCCCCCCCCC	70.89	-
230	Phosphorylation	EKEPPPPYLPA---- CCCCCCCCCCC----	30.96	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of LAP4A_RAT !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of LAP4A_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LAP4A_RAT !!

Protein-Protein Interaction

Oops, there are no PPI records of LAP4A_RAT !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.