UniProt ID | LAP4A_HUMAN | |
---|---|---|
UniProt AC | Q15012 | |
Protein Name | Lysosomal-associated transmembrane protein 4A | |
Gene Name | LAPTM4A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 233 | |
Subcellular Localization |
Endomembrane system Multi-pass membrane protein . May reside in an intracellular membrane-bound compartment. |
|
Protein Description | May function in the transport of nucleosides and/or nucleoside derivatives between the cytosol and the lumen of an intracellular membrane-bound compartment.. | |
Protein Sequence | MVSMSFKRNRSDRFYSTRCCGCCHVRTGTIILGTWYMVVNLLMAILLTVEVTHPNSMPAVNIQYEVIGNYYSSERMADNACVLFAVSVLMFIISSMLVYGAISYQVGWLIPFFCYRLFDFVLSCLVAISSLTYLPRIKEYLDQLPDFPYKDDLLALDSSCLLFIVLVFFALFIIFKAYLINCVWNCYKYINNRNVPEIAVYPAFEAPPQYVLPTYEMAVKMPEKEPPPPYLPA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MVSMSFKR -------CCCCCCCC | 4.55 | 25732826 | |
3 | Phosphorylation | -----MVSMSFKRNR -----CCCCCCCCCC | 13.86 | 26434776 | |
5 | Phosphorylation | ---MVSMSFKRNRSD ---CCCCCCCCCCCC | 21.80 | 30108239 | |
7 | 2-Hydroxyisobutyrylation | -MVSMSFKRNRSDRF -CCCCCCCCCCCCCC | 41.26 | - | |
7 | Ubiquitination | -MVSMSFKRNRSDRF -CCCCCCCCCCCCCC | 41.26 | 21890473 | |
11 | Phosphorylation | MSFKRNRSDRFYSTR CCCCCCCCCCCEECC | 36.37 | 24275569 | |
19 | S-palmitoylation | DRFYSTRCCGCCHVR CCCEECCCCCCCCCC | 2.07 | 29575903 | |
20 | S-palmitoylation | RFYSTRCCGCCHVRT CCEECCCCCCCCCCC | 4.16 | 29575903 | |
22 | S-palmitoylation | YSTRCCGCCHVRTGT EECCCCCCCCCCCCC | 0.63 | 29575903 | |
23 | S-palmitoylation | STRCCGCCHVRTGTI ECCCCCCCCCCCCCE | 1.70 | 29575903 | |
140 | Phosphorylation | YLPRIKEYLDQLPDF CHHHHHHHHHCCCCC | 15.58 | - | |
210 | Phosphorylation | AFEAPPQYVLPTYEM CCCCCCCCEECCHHH | 15.10 | 26356563 | |
214 | Phosphorylation | PPQYVLPTYEMAVKM CCCCEECCHHHHCCC | 28.14 | 26356563 | |
215 | Phosphorylation | PQYVLPTYEMAVKMP CCCEECCHHHHCCCC | 11.19 | 27259358 | |
220 | Ubiquitination | PTYEMAVKMPEKEPP CCHHHHCCCCCCCCC | 38.92 | 21906983 | |
224 | Ubiquitination | MAVKMPEKEPPPPYL HHCCCCCCCCCCCCC | 70.43 | 20972266 | |
230 | Phosphorylation | EKEPPPPYLPA---- CCCCCCCCCCC---- | 30.96 | 25159151 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LAP4A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LAP4A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LAP4A_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TFR1_HUMAN | TFRC | physical | 22096579 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"An extensive survey of tyrosine phosphorylation revealing new sitesin human mammary epithelial cells."; Heibeck T.H., Ding S.-J., Opresko L.K., Zhao R., Schepmoes A.A.,Yang F., Tolmachev A.V., Monroe M.E., Camp D.G. II, Smith R.D.,Wiley H.S., Qian W.-J.; J. Proteome Res. 8:3852-3861(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-230, AND MASSSPECTROMETRY. | |
"Global survey of phosphotyrosine signaling identifies oncogenickinases in lung cancer."; Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J.,Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L.,Mitchell J., Wetzel R., Macneill J., Ren J.M., Yuan J.,Bakalarski C.E., Villen J., Kornhauser J.M., Smith B., Li D., Zhou X.,Gygi S.P., Gu T.-L., Polakiewicz R.D., Rush J., Comb M.J.; Cell 131:1190-1203(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-230, AND MASSSPECTROMETRY. |