| UniProt ID | LAF2_SCHPO | |
|---|---|---|
| UniProt AC | O74443 | |
| Protein Name | SWIRM domain-containing protein laf2 | |
| Gene Name | laf2 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 272 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Component of the RPD3C(L) histone deacetylase complex (HDAC) responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events.. | |
| Protein Sequence | MQILKDQENLNPDGGSFVLITPPLSPPKQKSLSYTNISRRHGMRACMKGIVYEVYKNQPKLWLQQELIWLRRKRIHPIPKARRNNHVGRWANRHSNVSSSSGSRGRSSVSSRDSSPSYSGALRSAERSISSSPSTIEARRRKSARGNGLNGAIDVANLPFEELPNFCPDMSVLDNRTHPRTLKAEWKGPPLDLSDDPYRDLLHPAELHLASTLRLPCLIYLDNKKRIFAEWHHRRQQGLTFRKTDAQRASRVDVNKASRLWKAFHEVGFFDD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 21 | Phosphorylation | GGSFVLITPPLSPPK CCCEEEECCCCCCCC | 29996109 | ||
| 25 | Phosphorylation | VLITPPLSPPKQKSL EEECCCCCCCCCCCC | 25720772 | ||
| 108 | Phosphorylation | SGSRGRSSVSSRDSS CCCCCCCCCCCCCCC | 25720772 | ||
| 110 | Phosphorylation | SRGRSSVSSRDSSPS CCCCCCCCCCCCCCC | 25720772 | ||
| 111 | Phosphorylation | RGRSSVSSRDSSPSY CCCCCCCCCCCCCCH | 25720772 | ||
| 114 | Phosphorylation | SSVSSRDSSPSYSGA CCCCCCCCCCCHHHH | 29996109 | ||
| 115 | Phosphorylation | SVSSRDSSPSYSGAL CCCCCCCCCCHHHHH | 28889911 | ||
| 117 | Phosphorylation | SSRDSSPSYSGALRS CCCCCCCCHHHHHHH | 25720772 | ||
| 128 | Phosphorylation | ALRSAERSISSSPST HHHHHHHHHCCCCHH | 29996109 | ||
| 130 | Phosphorylation | RSAERSISSSPSTIE HHHHHHHCCCCHHHH | 28889911 | ||
| 131 | Phosphorylation | SAERSISSSPSTIEA HHHHHHCCCCHHHHH | 29996109 | ||
| 132 | Phosphorylation | AERSISSSPSTIEAR HHHHHCCCCHHHHHH | 28889911 | ||
| 135 | Phosphorylation | SISSSPSTIEARRRK HHCCCCHHHHHHHHH | 28889911 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LAF2_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LAF2_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LAF2_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of LAF2_SCHPO !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...