UniProt ID | LAF2_SCHPO | |
---|---|---|
UniProt AC | O74443 | |
Protein Name | SWIRM domain-containing protein laf2 | |
Gene Name | laf2 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 272 | |
Subcellular Localization | Nucleus . | |
Protein Description | Component of the RPD3C(L) histone deacetylase complex (HDAC) responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events.. | |
Protein Sequence | MQILKDQENLNPDGGSFVLITPPLSPPKQKSLSYTNISRRHGMRACMKGIVYEVYKNQPKLWLQQELIWLRRKRIHPIPKARRNNHVGRWANRHSNVSSSSGSRGRSSVSSRDSSPSYSGALRSAERSISSSPSTIEARRRKSARGNGLNGAIDVANLPFEELPNFCPDMSVLDNRTHPRTLKAEWKGPPLDLSDDPYRDLLHPAELHLASTLRLPCLIYLDNKKRIFAEWHHRRQQGLTFRKTDAQRASRVDVNKASRLWKAFHEVGFFDD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
21 | Phosphorylation | GGSFVLITPPLSPPK CCCEEEECCCCCCCC | 29996109 | ||
25 | Phosphorylation | VLITPPLSPPKQKSL EEECCCCCCCCCCCC | 25720772 | ||
108 | Phosphorylation | SGSRGRSSVSSRDSS CCCCCCCCCCCCCCC | 25720772 | ||
110 | Phosphorylation | SRGRSSVSSRDSSPS CCCCCCCCCCCCCCC | 25720772 | ||
111 | Phosphorylation | RGRSSVSSRDSSPSY CCCCCCCCCCCCCCH | 25720772 | ||
114 | Phosphorylation | SSVSSRDSSPSYSGA CCCCCCCCCCCHHHH | 29996109 | ||
115 | Phosphorylation | SVSSRDSSPSYSGAL CCCCCCCCCCHHHHH | 28889911 | ||
117 | Phosphorylation | SSRDSSPSYSGALRS CCCCCCCCHHHHHHH | 25720772 | ||
128 | Phosphorylation | ALRSAERSISSSPST HHHHHHHHHCCCCHH | 29996109 | ||
130 | Phosphorylation | RSAERSISSSPSTIE HHHHHHHCCCCHHHH | 28889911 | ||
131 | Phosphorylation | SAERSISSSPSTIEA HHHHHHCCCCHHHHH | 29996109 | ||
132 | Phosphorylation | AERSISSSPSTIEAR HHHHHCCCCHHHHHH | 28889911 | ||
135 | Phosphorylation | SISSSPSTIEARRRK HHCCCCHHHHHHHHH | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LAF2_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LAF2_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LAF2_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of LAF2_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...