UniProt ID | KTHY_MOUSE | |
---|---|---|
UniProt AC | P97930 | |
Protein Name | Thymidylate kinase | |
Gene Name | Dtymk | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 212 | |
Subcellular Localization | ||
Protein Description | Catalyzes the conversion of dTMP to dTDP.. | |
Protein Sequence | MASRRGALIVLEGVDRAGKTTQGLKLVTALCASGHRAELLRFPERSTEIGKLLNSYLEKKTELEDHSVHLLFSANRWEQVPLIKAKLNQGVTLVLDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLILFLQLQLLDAAARGEFGLERYETGTFQKQVLLCFQQLMEEKNLNWKVVDASKSIEEVHKEIRAHSEDAIRNAAQRPLGELWK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MASRRGALI ------CCCCCCEEE | 16.25 | - | |
51 | Ubiquitination | ERSTEIGKLLNSYLE HHHHHHHHHHHHHHH | 56.30 | 22790023 | |
59 | Acetylation | LLNSYLEKKTELEDH HHHHHHHHCCCCCCC | 63.50 | 15628781 | |
189 | Acetylation | KSIEEVHKEIRAHSE HHHHHHHHHHHHCCH | 61.07 | 23864654 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KTHY_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KTHY_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KTHY_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of KTHY_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...