dbPTM

KRT82_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	KRT82_MOUSE
UniProt AC	Q99M74
Protein Name	Keratin, type II cuticular Hb2
Gene Name	Krt82
Organism	Mus musculus (Mouse).
Sequence Length	516
Subcellular Localization
Protein Description
Protein Sequence	MSCRNFQLSPRCGNRSFSSCSAIMPRMVTHYEVSKAPCRSGGGGGLRALGCLGSRSLCNVGFGRPRVASRCGMPGFGYRAGATCGSSACITPVTINESLLVPLELEIDPTVQRVKRDEKEQIKCLNNRFASFINKVRFLEQKNKLLETKWNFMQQQRSCQSNMEPLFEGYICALRRQLDCVSGDHGRLEAELCSLQEALEGYKKKYEEELSLRPCAENEFVTLKKDVDTAFLVKADLETNLEALEHEIEFLKALFEEEIGLLQSQISETSVIVKMDNSRELDVDGIVAEIKAQYDDIASRSKAEAEAWYQCRYEELRLTAGNHCDNLRNRKNEILEMNKLIQRLQQDIEAVKGQRCKLEGAIAQAEQQGEAALTDAKCKLAGLEEALQKAKQDMACLLKQYQEVMNCKLGLDIEIATYRRLLEGEEHRLCEGIGPVNISVSSSKGAVLYEPCVMGTPMLRTEYCTGTTGVLRNSGGCNVVGTGELYIPCEPQGLLGCGNGRSSSMKVGVGSNSCSR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
131	Phosphorylation	CLNNRFASFINKVRF HHHHHHHHHHHHHHH	24.77	20139300
211	Phosphorylation	KKYEEELSLRPCAEN HHHHHHHCCCCCCCC	26.13	25159016
417	Phosphorylation	GLDIEIATYRRLLEG CCCEEHHHHHHHHCC	24.19	30482847
511	Phosphorylation	SMKVGVGSNSCSR-- CCEEECCCCCCCC--	24.14	23375375
513	Phosphorylation	KVGVGSNSCSR---- EEECCCCCCCC----	18.37	23375375
515	Phosphorylation	GVGSNSCSR------ ECCCCCCCC------	40.63	23375375

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of KRT82_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of KRT82_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of KRT82_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of KRT82_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of KRT82_MOUSE

Related Literatures of Post-Translational Modification