KRR1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: KRR1_MOUSE
• UniProt AC: Q8BGA5
• Protein Name: KRR1 small subunit processome component homolog
• Gene Name: Krr1
• Organism: Mus musculus (Mouse).
• Sequence Length: 380
• Subcellular Localization: Cytoplasm . Nucleus . Nucleus, nucleolus .
• Protein Description: Required for 40S ribosome biogenesis. Involved in nucleolar processing of pre-18S ribosomal RNA and ribosome assembly (By similarity)..
• Protein Sequence: MATSAEAPAKEAQKRDSQPQKQKRETQDEAELLTVPDGWKEPAFSKEDNPRGLLEESSFATLFPKYREAYLKECWPLVQKALNEHHVKATLDLIEGSMTVCTTKKTFDPYIIIRARDLIKLLARSVSFEQAVRILQDDVACDIIKIGSLVRNKERFVKRRQRLIGPKGSTLKALELLTNCYVMVQGNTVSAIGPFSGLKEVRKVVLDTMKNIHPIYNIKTLMIKRELAKDSELRSQSWERFLPQFKHKNVNKRKEPKKKSVKKEYTPFPPPQPESQIDKELASGEYFLKASQKKRQKMEAIKAKQAEALTKRQEERNKAFIPPKEKPAVKPKEASTETKIDVAAIKEKVKKAKTKKLGALTAEEVKLKMEADEKKQKRKK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Phosphorylation	----MATSAEAPAKE ----CCCCCCCCHHH	17.99	-
148	Phosphorylation	CDIIKIGSLVRNKER CCEEHHCHHHHCHHH	27.45	-
266	Phosphorylation	KSVKKEYTPFPPPQP CCCCCCCCCCCCCCC	21.39	23375375
275	Phosphorylation	FPPPQPESQIDKELA CCCCCCHHHHCHHHH	38.84	23375375

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of KRR1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of KRR1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of KRR1_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of KRR1_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.