dbPTM

KRR1_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	KRR1_DROME
UniProt AC	Q9VPU8
Protein Name	KRR1 small subunit processome component homolog {ECO:0000250\|UniProtKB:Q8BGA5}
Gene Name	dbe
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	345
Subcellular Localization	Nucleus, nucleolus . Exogenous expression in embryos shows a predominant localization in nucleoplasm in some epidermal cells while most other cells show perinucleolar ring structure. In heat-shocked third instar larvae, localization varies among cell
Protein Description	Required for 40S ribosome biogenesis. Involved in nucleolar processing of pre-18S ribosomal RNA and ribosome assembly. Binds to RNA. Required for female germline development, cell viability during eye development and for survival of dividing cells and epithelial cells during early wing disk development..
Protein Sequence	MSESEAEETKISTEPVDNAWSMKIPAFRQEDNPHGMVEESSFATLFPKYRERYLKEVWPLVEQCLAEHHLKAELDLMEGSMVVKTSRKTWDPYIIIKARDMIKLMARSVPFEQAKRVLQDDIGCDIIKIGNLVHKKEKFVKRRQRLIGPNGATLKSIELLTDCYVLVQGNTVSALGPYKGLQQVRDIVLETMNNVHPIYNIKALMIKRELMKDPRLANEDWSRFLPKFKNKNISKRKQPKVKKQKKEYTPFPPSQPESKVDKQLASGEYFLNQEQKQAKRNQERTEKQKEAAKRQDERRNKDFVPPTEESAASSRKKEDGSSSSKVDVKALKAKLIKANKKARSS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
2	Phosphorylation	------MSESEAEET ------CCHHHHHCC	50.24	19429919
4	Phosphorylation	----MSESEAEETKI ----CCHHHHHCCCC	34.50	19429919

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of KRR1_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of KRR1_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of KRR1_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
KRI1_DROME	CG5645	physical	22036573

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of KRR1_DROME

Related Literatures of Post-Translational Modification