UniProt ID | KRR1_DROME | |
---|---|---|
UniProt AC | Q9VPU8 | |
Protein Name | KRR1 small subunit processome component homolog {ECO:0000250|UniProtKB:Q8BGA5} | |
Gene Name | dbe | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 345 | |
Subcellular Localization | Nucleus, nucleolus . Exogenous expression in embryos shows a predominant localization in nucleoplasm in some epidermal cells while most other cells show perinucleolar ring structure. In heat-shocked third instar larvae, localization varies among cell | |
Protein Description | Required for 40S ribosome biogenesis. Involved in nucleolar processing of pre-18S ribosomal RNA and ribosome assembly. Binds to RNA. Required for female germline development, cell viability during eye development and for survival of dividing cells and epithelial cells during early wing disk development.. | |
Protein Sequence | MSESEAEETKISTEPVDNAWSMKIPAFRQEDNPHGMVEESSFATLFPKYRERYLKEVWPLVEQCLAEHHLKAELDLMEGSMVVKTSRKTWDPYIIIKARDMIKLMARSVPFEQAKRVLQDDIGCDIIKIGNLVHKKEKFVKRRQRLIGPNGATLKSIELLTDCYVLVQGNTVSALGPYKGLQQVRDIVLETMNNVHPIYNIKALMIKRELMKDPRLANEDWSRFLPKFKNKNISKRKQPKVKKQKKEYTPFPPSQPESKVDKQLASGEYFLNQEQKQAKRNQERTEKQKEAAKRQDERRNKDFVPPTEESAASSRKKEDGSSSSKVDVKALKAKLIKANKKARSS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KRR1_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KRR1_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KRR1_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
KRI1_DROME | CG5645 | physical | 22036573 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...