UniProt ID | KRCC1_HUMAN | |
---|---|---|
UniProt AC | Q9NPI7 | |
Protein Name | Lysine-rich coiled-coil protein 1 | |
Gene Name | KRCC1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 259 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MKHSKKTYDSFQDELEDYIKVQKARGLEPKTCFRKMKGDYLETCGYKGEVNSRPTYRMFDQRLPSETIQTYPRSCNIPQTVENRLPQWLPAHDSRLRLDSLSYCQFTRDCFSEKPVPLNFNQQEYICGSHGVEHRVYKHFSSDNSTSTHQASHKQIHQKRKRHPEEGREKSEEERSKHKRKKSCEEIDLDKHKSIQRKKTEVEIETVHVSTEKLKNRKEKKSRDVVSKKEERKRTKKKKEQGQERTEEEMLWDQSILGF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
40 | Phosphorylation | FRKMKGDYLETCGYK HHHHCCCEECCCCCC | 18.33 | - | |
43 | Phosphorylation | MKGDYLETCGYKGEV HCCCEECCCCCCCCC | 14.50 | - | |
46 | Phosphorylation | DYLETCGYKGEVNSR CEECCCCCCCCCCCC | 20.26 | - | |
65 | Phosphorylation | MFDQRLPSETIQTYP CCCCCCCCCHHCCCC | 52.55 | 29083192 | |
67 | Phosphorylation | DQRLPSETIQTYPRS CCCCCCCHHCCCCCC | 23.79 | 29083192 | |
70 | Phosphorylation | LPSETIQTYPRSCNI CCCCHHCCCCCCCCC | 31.48 | 29083192 | |
71 | Phosphorylation | PSETIQTYPRSCNIP CCCHHCCCCCCCCCC | 4.73 | 29083192 | |
100 | Phosphorylation | DSRLRLDSLSYCQFT CCCCCHHHCCEECCC | 24.65 | 24719451 | |
102 | Phosphorylation | RLRLDSLSYCQFTRD CCCHHHCCEECCCCC | 28.02 | 26552605 | |
103 | Phosphorylation | LRLDSLSYCQFTRDC CCHHHCCEECCCCCC | 8.79 | 26552605 | |
107 | Phosphorylation | SLSYCQFTRDCFSEK HCCEECCCCCCCCCC | 10.34 | 26552605 | |
137 | Phosphorylation | HGVEHRVYKHFSSDN CCCHHEEEECCCCCC | 9.94 | - | |
171 | Phosphorylation | PEEGREKSEEERSKH HHHHHHHCHHHHHHH | 45.55 | 22964224 | |
183 | Phosphorylation | SKHKRKKSCEEIDLD HHHHHHHCHHHCCHH | 29.78 | 25159151 | |
237 | Methylation | EERKRTKKKKEQGQE HHHHHHHHHHHHHHH | 69.35 | 23644510 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KRCC1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KRCC1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KRCC1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of KRCC1_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...