dbPTM

KRA99_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	KRA99_HUMAN
UniProt AC	Q9BYP9
Protein Name	Keratin-associated protein 9-9
Gene Name	KRTAP9-9
Organism	Homo sapiens (Human).
Sequence Length	154
Subcellular Localization
Protein Description	In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins..
Protein Sequence	MTHCCSPCCQPTCCRTTCCRTTCWKPTTVTTCSSTPCCQPSCCVSSCCQPCCRPACCQNTCCRTTCCQPTCLSSCCGQTSCGSSCGQSSSCAPVYCRRTCYYPTTVCLPGCLNQSCGSSCCQPCCRPACCETTCCRTTCFQPTCVSSCCQPSCC

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MTHCCSPCC ------CCCCCCCCC	24.50	24043423
6	Phosphorylation	--MTHCCSPCCQPTC --CCCCCCCCCCCCE	26.77	24043423
12	Phosphorylation	CSPCCQPTCCRTTCC CCCCCCCCEECCEEE	9.81	24043423
16	Phosphorylation	CQPTCCRTTCCRTTC CCCCEECCEEECCCC	15.40	24043423
17	Phosphorylation	QPTCCRTTCCRTTCW CCCEECCEEECCCCC	7.11	24043423
147	Phosphorylation	FQPTCVSSCCQPSCC CCCCCHHHCCCCCCC	9.87	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of KRA99_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of KRA99_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of KRA99_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of KRA99_HUMAN !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of KRA99_HUMAN

Related Literatures of Post-Translational Modification