KRA91_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: KRA91_HUMAN
• UniProt AC: A8MXZ3
• Protein Name: Keratin-associated protein 9-1 {ECO:0000305}
• Gene Name: KRTAP9-1 {ECO:0000312|HGNC:HGNC:18912}
• Organism: Homo sapiens (Human).
• Sequence Length: 250
• Protein Description: In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins (By similarity)..
• Protein Sequence: MTHCCSPCCQPTCCRTTCCRTTCWKPTTVTTCSSTPCCQPSCCVPSCCQPCCHPTCCQNTCCRTTCCQPTCVASCCQPSCCSTPCCQPTCCGSSCCGQTSCGSSCCQPICGSSCCQPCCHPTCYQTICFRTTCCQPTCCQPTCCRNTSCQPTCCGSSCCQPCCHPTCCQTICRSTCCQPSCVTRCCSTPCCQPTCGGSSCCSQTCNESSYCLPCCRPTCCQTTCYRTTCCRPSCCCSPCCVSSCCQPSCC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MTHCCSPCC ------CCCCCCCCC	24.50	24043423
6	Phosphorylation	--MTHCCSPCCQPTC --CCCCCCCCCCCCE	26.77	24043423
12	Phosphorylation	CSPCCQPTCCRTTCC CCCCCCCCEECCEEE	9.81	24043423
16	Phosphorylation	CQPTCCRTTCCRTTC CCCCEECCEEECCCC	15.40	24043423
17	Phosphorylation	QPTCCRTTCCRTTCW CCCEECCEEECCCCC	7.11	24043423
132	Phosphorylation	QTICFRTTCCQPTCC CEEEEECCCCCCCCC	13.66	-
222	Phosphorylation	CRPTCCQTTCYRTTC CCCCCCCCEEECCCC	12.62	30576142
227	Phosphorylation	CQTTCYRTTCCRPSC CCCEEECCCCCCCCC	9.56	30576142
228	Phosphorylation	QTTCYRTTCCRPSCC CCEEECCCCCCCCCE	10.70	30576142

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of KRA91_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of KRA91_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of KRA91_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of KRA91_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.