dbPTM

KMCP1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	KMCP1_HUMAN
UniProt AC	Q5SVS4
Protein Name	Kidney mitochondrial carrier protein 1
Gene Name	SLC25A30
Organism	Homo sapiens (Human).
Sequence Length	291
Subcellular Localization	Mitochondrion inner membrane Multi-pass membrane protein.
Protein Description	Probable transporter..
Protein Sequence	MSALNWKPFVYGGLASITAECGTFPIDLTKTRLQIQGQTNDAKFKEIRYRGMLHALVRIGREEGLKALYSGIAPAMLRQASYGTIKIGTYQSLKRLFIERPEDETLPINVICGILSGVISSTIANPTDVLKIRMQAQSNTIQGGMIGNFMNIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHLILSGLMGDTVYTHFLSSFTCGLAGALASNPVDVVRTRMMNQRVLRDGRCSGYTGTLDCLLQTWKNEGFFALYKGFWPNWLRLGPWNIIFFVTYEQLKKLDL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSALNWKPF ------CCCCCCCCE	41.27	25944712
39	O-linked_Glycosylation	RLQIQGQTNDAKFKE EEEEECCCCCHHHHH	41.72	29351928
43	Ubiquitination	QGQTNDAKFKEIRYR ECCCCCHHHHHHHHH	60.89	21906983
127	Phosphorylation	SSTIANPTDVLKIRM HHCCCCCCHHHHHHH	38.25	-
226	Phosphorylation	NPVDVVRTRMMNQRV CCHHHHHHHHHCCHH	16.00	28787133
282	Phosphorylation	WNIIFFVTYEQLKKL EEEEEEEEHHHHHCC	19.04	27251275

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of KMCP1_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of KMCP1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of KMCP1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of KMCP1_HUMAN !!

Drug and Disease Associations

Kegg Disease
There are no disease associations of PTM sites.
OMIM Disease
There are no disease associations of PTM sites.
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of KMCP1_HUMAN

Related Literatures of Post-Translational Modification