KLRA3_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: KLRA3_MOUSE
• UniProt AC: Q64329
• Protein Name: Killer cell lectin-like receptor 3
• Gene Name: Klra3
• Organism: Mus musculus (Mouse).
• Sequence Length: 266
• Subcellular Localization: Membrane; Single-pass type II membrane protein.
• Protein Description: Receptor on natural killer (NK) cells for class I MHC..
• Protein Sequence: MSEPEVTYSTVRLHKSSGLQKLVRHEETQGPREVGNRKCSAPWQLIVKALGILCFLLLVTVAVLAVKIFQYNQHKQEINETLNHHHNCSNMQRAFNLKEEMLTNKSIDCRPSNETLEYIKREQDRWDSKTKTVLDSSRDTGRGVKYWFCYSTKCYYFIMNKTTWSGCKANCQHYSVPILKIEDEDELKFLQRHVIPENYWIGLSYDKKKKEWAWIDNGPSKLDMKIRKMNFKSRGCVFLSKARIEDIDCNIPYYCICGKKLDKFPD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
79	N-linked_Glycosylation	NQHKQEINETLNHHH HHHHHHHHHHHCHHC	35.13	-
87	N-linked_Glycosylation	ETLNHHHNCSNMQRA HHHCHHCCCHHHHHH	26.93	-
104	N-linked_Glycosylation	LKEEMLTNKSIDCRP CCHHHHHCCCCCCCC	31.92	-
113	N-linked_Glycosylation	SIDCRPSNETLEYIK CCCCCCCCHHHHHHH	49.29	-
160	N-linked_Glycosylation	KCYYFIMNKTTWSGC CEEEEEEECCCCCCC	33.43	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of KLRA3_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of KLRA3_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of KLRA3_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of KLRA3_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.