UniProt ID | KLRA3_MOUSE | |
---|---|---|
UniProt AC | Q64329 | |
Protein Name | Killer cell lectin-like receptor 3 | |
Gene Name | Klra3 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 266 | |
Subcellular Localization |
Membrane Single-pass type II membrane protein. |
|
Protein Description | Receptor on natural killer (NK) cells for class I MHC.. | |
Protein Sequence | MSEPEVTYSTVRLHKSSGLQKLVRHEETQGPREVGNRKCSAPWQLIVKALGILCFLLLVTVAVLAVKIFQYNQHKQEINETLNHHHNCSNMQRAFNLKEEMLTNKSIDCRPSNETLEYIKREQDRWDSKTKTVLDSSRDTGRGVKYWFCYSTKCYYFIMNKTTWSGCKANCQHYSVPILKIEDEDELKFLQRHVIPENYWIGLSYDKKKKEWAWIDNGPSKLDMKIRKMNFKSRGCVFLSKARIEDIDCNIPYYCICGKKLDKFPD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
79 | N-linked_Glycosylation | NQHKQEINETLNHHH HHHHHHHHHHHCHHC | 35.13 | - | |
87 | N-linked_Glycosylation | ETLNHHHNCSNMQRA HHHCHHCCCHHHHHH | 26.93 | - | |
104 | N-linked_Glycosylation | LKEEMLTNKSIDCRP CCHHHHHCCCCCCCC | 31.92 | - | |
113 | N-linked_Glycosylation | SIDCRPSNETLEYIK CCCCCCCCHHHHHHH | 49.29 | - | |
160 | N-linked_Glycosylation | KCYYFIMNKTTWSGC CEEEEEEECCCCCCC | 33.43 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KLRA3_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KLRA3_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KLRA3_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of KLRA3_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...