| UniProt ID | KLF3_MOUSE | |
|---|---|---|
| UniProt AC | Q60980 | |
| Protein Name | Krueppel-like factor 3 | |
| Gene Name | Klf3 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 344 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Binds to the CACCC box of erythroid cell-expressed genes. May play a role in hematopoiesis.. | |
| Protein Sequence | MLMFDPVPVKQEAMDPVSVSFPSNYIESMKPNKYGVIYSTPLPDKFFQTPEGLTHGIQVEPVDLTVNKRGSPPAAGGSPSSLKFPSHRRASPGLSMPSSSPPIKKYSPPSPGVQPFGVPLSMPPVMAAALSRHGIRSPGILPVIQPVVVQPVPFMYTSHLQQPLMVSLSEEMDNSNSGMPVPVIESYEKPLLQKKIKIEPGIEPQRTDYYPEEMSPPLMNPVSPPQALLQENHPSVIVQPGKRPLPVESPDTQRKRRIHRCDYDGCNKVYTKSSHLKAHRRTHTGEKPYKCTWEGCTWKFARSDELTRHFRKHTGIKPFQCPDCDRSFSRSDHLALHRKRHMLV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 10 | Sumoylation | MFDPVPVKQEAMDPV CCCCCCCCCCCCCCC | 36.03 | - | |
| 10 | Sumoylation | MFDPVPVKQEAMDPV CCCCCCCCCCCCCCC | 36.03 | 15684403 | |
| 71 | Phosphorylation | LTVNKRGSPPAAGGS EEEECCCCCCCCCCC | 31.57 | 25521595 | |
| 78 | Phosphorylation | SPPAAGGSPSSLKFP CCCCCCCCCHHCCCC | 22.23 | 25521595 | |
| 80 | Phosphorylation | PAAGGSPSSLKFPSH CCCCCCCHHCCCCCC | 50.42 | 25168779 | |
| 81 | Phosphorylation | AAGGSPSSLKFPSHR CCCCCCHHCCCCCCC | 38.67 | 21082442 | |
| 86 | Phosphorylation | PSSLKFPSHRRASPG CHHCCCCCCCCCCCC | 32.53 | 25168779 | |
| 91 | Phosphorylation | FPSHRRASPGLSMPS CCCCCCCCCCCCCCC | 20.07 | 25521595 | |
| 95 | Phosphorylation | RRASPGLSMPSSSPP CCCCCCCCCCCCCCC | 34.26 | 25168779 | |
| 98 | Phosphorylation | SPGLSMPSSSPPIKK CCCCCCCCCCCCCCC | 34.50 | 25521595 | |
| 99 | Phosphorylation | PGLSMPSSSPPIKKY CCCCCCCCCCCCCCC | 40.78 | 27087446 | |
| 100 | Phosphorylation | GLSMPSSSPPIKKYS CCCCCCCCCCCCCCC | 38.75 | 27087446 | |
| 106 | Phosphorylation | SSPPIKKYSPPSPGV CCCCCCCCCCCCCCC | 22.77 | 26239621 | |
| 107 | Phosphorylation | SPPIKKYSPPSPGVQ CCCCCCCCCCCCCCC | 38.93 | 26239621 | |
| 110 | Phosphorylation | IKKYSPPSPGVQPFG CCCCCCCCCCCCCCC | 37.36 | 26824392 | |
| 121 | Phosphorylation | QPFGVPLSMPPVMAA CCCCCCCCCCHHHHH | 24.15 | 26643407 | |
| 197 | Sumoylation | PLLQKKIKIEPGIEP CHHHCCCCCCCCCCC | 50.31 | - | |
| 207 | Phosphorylation | PGIEPQRTDYYPEEM CCCCCCCCCCCCHHC | 24.09 | 26643407 | |
| 209 | Phosphorylation | IEPQRTDYYPEEMSP CCCCCCCCCCHHCCC | 21.95 | 26643407 | |
| 210 | Phosphorylation | EPQRTDYYPEEMSPP CCCCCCCCCHHCCCC | 13.64 | 26643407 | |
| 215 | Phosphorylation | DYYPEEMSPPLMNPV CCCCHHCCCCCCCCC | 27.01 | 21149613 | |
| 223 | Phosphorylation | PPLMNPVSPPQALLQ CCCCCCCCCCHHHHH | 31.92 | 21149613 | |
| 235 | Phosphorylation | LLQENHPSVIVQPGK HHHCCCCCEEECCCC | 19.54 | 21149613 | |
| 249 | Phosphorylation | KRPLPVESPDTQRKR CCCCCCCCCCHHHCC | 28.45 | 27087446 | |
| 252 | Phosphorylation | LPVESPDTQRKRRIH CCCCCCCHHHCCCCC | 33.39 | 25619855 | |
| 284 | Phosphorylation | KAHRRTHTGEKPYKC HHCCCCCCCCCCCEE | 46.56 | - | |
| 327 | Phosphorylation | QCPDCDRSFSRSDHL CCCCCCCCCCHHHHH | 17.83 | 23140645 | |
| 329 | Phosphorylation | PDCDRSFSRSDHLAL CCCCCCCCHHHHHHH | 31.92 | 23140645 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KLF3_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference |
|---|---|---|---|---|
| 197 | K | Sumoylation |
| 15684403 |
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KLF3_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SQSTM_MOUSE | Sqstm1 | physical | 23754749 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Solid tumor proteome and phosphoproteome analysis by high resolutionmass spectrometry."; Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J.,Faessler R., Mann M.; J. Proteome Res. 7:5314-5326(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-71 AND SER-91, AND MASSSPECTROMETRY. | |
| Sumoylation | |
| Reference | PubMed |
| "Role for SUMO modification in facilitating transcriptional repressionby BKLF."; Perdomo J., Verger A., Turner J., Crossley M.; Mol. Cell. Biol. 25:1549-1559(2005). Cited for: SUMOYLATION AT LYS-10 AND LYS-197, FUNCTION, AND MUTAGENESIS OFLYS-10; GLU-12; LYS-197 AND GLU-199. | |