UniProt ID | KISHB_HUMAN | |
---|---|---|
UniProt AC | Q9NRX6 | |
Protein Name | Protein kish-B | |
Gene Name | TMEM167B | |
Organism | Homo sapiens (Human). | |
Sequence Length | 74 | |
Subcellular Localization |
Golgi apparatus membrane Single-pass type I membrane protein . |
|
Protein Description | Involved in the early part of the secretory pathway.. | |
Protein Sequence | MTNVYSLDGILVFGLLFVCTCAYFKKVPRLKTWLLSEKKGVWGVFYKAAVIGTRLHAAVAIACVVMAFYVLFIK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
31 | Ubiquitination | FKKVPRLKTWLLSEK HCCCCHHHHHHHCCC | 38.65 | - | |
36 | Phosphorylation | RLKTWLLSEKKGVWG HHHHHHHCCCCCCHH | 45.24 | 24719451 | |
38 | Ubiquitination | KTWLLSEKKGVWGVF HHHHHCCCCCCHHHH | 51.99 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KISHB_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KISHB_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KISHB_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of KISHB_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...