| UniProt ID | KISHA_HUMAN | |
|---|---|---|
| UniProt AC | Q8TBQ9 | |
| Protein Name | Protein kish-A | |
| Gene Name | TMEM167A | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 72 | |
| Subcellular Localization |
Golgi apparatus membrane Single-pass type I membrane protein . |
|
| Protein Description | Involved in the early part of the secretory pathway.. | |
| Protein Sequence | MSAIFNFQSLLTVILLLICTCAYIRSLAPSLLDRNKTGLLGIFWKCARIGERKSPYVAVCCIVMAFSILFIQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSAIFNFQS ------CCHHHHHHH | 30.03 | 24043423 | |
| 9 | Phosphorylation | SAIFNFQSLLTVILL CHHHHHHHHHHHHHH | 22.62 | 24043423 | |
| 12 | Phosphorylation | FNFQSLLTVILLLIC HHHHHHHHHHHHHHH | 15.70 | 24043423 | |
| 20 | Phosphorylation | VILLLICTCAYIRSL HHHHHHHHHHHHHHH | 7.99 | 24043423 | |
| 23 | Phosphorylation | LLICTCAYIRSLAPS HHHHHHHHHHHHCHH | 10.06 | 24043423 | |
| 34 | Methylation | LAPSLLDRNKTGLLG HCHHHHCCCCCCHHH | 46.65 | 115918617 | |
| 35 | N-linked_Glycosylation | APSLLDRNKTGLLGI CHHHHCCCCCCHHHH | 46.00 | UniProtKB CARBOHYD | |
| 36 | Ubiquitination | PSLLDRNKTGLLGIF HHHHCCCCCCHHHHH | 44.88 | 21890473 | |
| 45 | Ubiquitination | GLLGIFWKCARIGER CHHHHHHHHHHHCCC | 13.78 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KISHA_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KISHA_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KISHA_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of KISHA_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
