| UniProt ID | KI2S1_HUMAN | |
|---|---|---|
| UniProt AC | Q14954 | |
| Protein Name | Killer cell immunoglobulin-like receptor 2DS1 {ECO:0000305} | |
| Gene Name | KIR2DS1 {ECO:0000312|HGNC:HGNC:6333} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 304 | |
| Subcellular Localization |
Cell membrane Single-pass type I membrane protein Extracellular side . |
|
| Protein Description | Receptor on natural killer (NK) cells for some HLA-C alleles such as w6. Does not inhibit the activity of NK cells.. | |
| Protein Sequence | MSLTVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMKQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGTKVNGTFQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLHVLIGTSVVKIPFTILLFFLLHRWCSDKKNAAVMDQEPAGNRTVNSEDSDEQDHQEVSYA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSLTVVSMA ------CCCCHHHHH | 32.52 | 26074081 | |
| 4 | Phosphorylation | ----MSLTVVSMACV ----CCCCHHHHHHH | 16.14 | 26074081 | |
| 30 | Phosphorylation | EGVHRKPSLLAHPGR CCCCCCHHHHCCCCC | 38.76 | 24719451 | |
| 51 | Phosphorylation | TVILQCWSDVMFEHF EEEEHHHHHHHHHHH | 28.14 | - | |
| 67 | N-linked_Glycosylation | LHREGMFNDTLRLIG HHCCCCCHHHHHHHH | 32.25 | UniProtKB CARBOHYD | |
| 84 | N-linked_Glycosylation | HDGVSKANFSISRMK CCCCCCCCEEHHHHH | 34.63 | UniProtKB CARBOHYD | |
| 98 | Phosphorylation | KQDLAGTYRCYGSVT HHHHCCCEEEEEEEC | 9.58 | - | |
| 109 | Phosphorylation | GSVTHSPYQLSAPSD EEECCCCCCCCCCCC | 25.71 | 18083107 | |
| 144 | N-linked_Glycosylation | PTVLAGENVTLSCSS CEEECCCCEEEEECC | 31.02 | UniProtKB CARBOHYD | |
| 178 | N-linked_Glycosylation | LPAGTKVNGTFQANF CCCCCEECCEEEECC | 45.39 | UniProtKB CARBOHYD |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KI2S1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KI2S1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KI2S1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of KI2S1_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...