dbPTM

KCTD9_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	KCTD9_MOUSE
UniProt AC	Q80UN1
Protein Name	BTB/POZ domain-containing protein KCTD9
Gene Name	Kctd9
Organism	Mus musculus (Mouse).
Sequence Length	339
Subcellular Localization
Protein Description	Substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex, which mediates the ubiquitination of target proteins, leading to their degradation by the proteasome..
Protein Sequence	MRRVTLFLNGSPSNGKVVAVYGTLSDLLSVASSKLGIKATSVYNGKGGLIDDIALIRDDDVLFVCEGEPFIDPQTDARPPGGLLGSHTDWLTLNVGGRYFTTTRSTLVNKEPDSMLAHMFKDKGVWGNKQDHRGAFLIDRSPEYFEPILNYLRHGQLIVNDGINLLGVLEEARFFGIDSLIEHLEVAIKNSQPPEDHSPISRKEFVRFLLATPTKSELRCQCANLQGVKMLCSNAEGASLRLCNFEDPSGLKANLEGANLKGVDMEGSQMTGINLRVATLKNAKLKNCNLRGATLAGTDLENCDLSGCDLQEANLRGSNVKGAIFEEMLTPLHMSQSVR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
11	Phosphorylation	VTLFLNGSPSNGKVV EEEEECCCCCCCEEE	24.87	-
21	Phosphorylation	NGKVVAVYGTLSDLL CCEEEEEEEEHHHHH	8.48	25777480
23	Phosphorylation	KVVAVYGTLSDLLSV EEEEEEEEHHHHHHH	12.85	25777480
25	Phosphorylation	VAVYGTLSDLLSVAS EEEEEEHHHHHHHHH	26.50	25777480
29	Phosphorylation	GTLSDLLSVASSKLG EEHHHHHHHHHHHCC	23.96	25777480
32	Phosphorylation	SDLLSVASSKLGIKA HHHHHHHHHHCCCEE	26.33	25777480
33	Phosphorylation	DLLSVASSKLGIKAT HHHHHHHHHCCCEEE	23.35	25777480

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of KCTD9_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of KCTD9_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of KCTD9_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of KCTD9_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of KCTD9_MOUSE

Related Literatures of Post-Translational Modification