KCTD8_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: KCTD8_HUMAN
• UniProt AC: Q6ZWB6
• Protein Name: BTB/POZ domain-containing protein KCTD8
• Gene Name: KCTD8
• Organism: Homo sapiens (Human).
• Sequence Length: 473
• Subcellular Localization: Cell junction, synapse, presynaptic cell membrane. Cell junction, synapse, postsynaptic cell membrane.
• Protein Description: Auxiliary subunit of GABA-B receptors that determine the pharmacology and kinetics of the receptor response. Increases agonist potency and markedly alter the G-protein signaling of the receptors by accelerating onset and promoting desensitization (By similarity)..
• Protein Sequence: MALKDTGSGGSTILPISEMVSSSSSPGASAAAAPGPCAPSPFPEVVELNVGGQVYVTKHSTLLSVPDSTLASMFSPSSPRGGARRRGELPRDSRARFFIDRDGFLFRYVLDYLRDKQLALPEHFPEKERLLREAEYFQLTDLVKLLSPKVTKQNSLNDEGCQSDLEDNVSQGSSDALLLRGAAAAVPSGPGAHGGGGGGGAQDKRSGFLTLGYRGSYTTVRDNQADAKFRRVARIMVCGRIALAKEVFGDTLNESRDPDRQPEKYTSRFYLKFTYLEQAFDRLSEAGFHMVACNSSGTAAFVNQYRDDKIWSSYTEYIFFRPPQKIVSPKQEHEDRKHDKVTDKGSESGTSCNELSTSSCDSHSEASTPQDNPSSAQQATAHQPNTLTLDRPSKKAPVQWIPPPDKRRNSELFQTLISKSRETNLSKKKVCEKLSVEEEMKKCIQDFKKIHIPDYFPERKRQWQSELLQKYGL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
64	Phosphorylation	TKHSTLLSVPDSTLA ECCCEEEECCCCHHH	34.41	24076635
68	Phosphorylation	TLLSVPDSTLASMFS EEEECCCCHHHHHCC	21.17	24076635
69	Phosphorylation	LLSVPDSTLASMFSP EEECCCCHHHHHCCC	33.45	24076635
75	Phosphorylation	STLASMFSPSSPRGG CHHHHHCCCCCCCCC	18.41	29523821
77	Phosphorylation	LASMFSPSSPRGGAR HHHHCCCCCCCCCCC	52.34	28450419
78	Phosphorylation	ASMFSPSSPRGGARR HHHCCCCCCCCCCCC	23.23	28450419
80	Methylation	MFSPSSPRGGARRRG HCCCCCCCCCCCCCC	59.11	-
144	Ubiquitination	FQLTDLVKLLSPKVT HHHHHHHHHHCCCCC	51.51	-
147	Phosphorylation	TDLVKLLSPKVTKQN HHHHHHHCCCCCCCC	32.86	24719451
251	Phosphorylation	AKEVFGDTLNESRDP HHHHHCCCCCCCCCC	31.68	26471730
255	Phosphorylation	FGDTLNESRDPDRQP HCCCCCCCCCCCCCC	40.69	26471730
265	Phosphorylation	PDRQPEKYTSRFYLK CCCCCCCCCHHHHEE	14.32	26074081
266	Phosphorylation	DRQPEKYTSRFYLKF CCCCCCCCHHHHEEH	25.21	26074081
267	Phosphorylation	RQPEKYTSRFYLKFT CCCCCCCHHHHEEHH	19.80	26074081
270	Phosphorylation	EKYTSRFYLKFTYLE CCCCHHHHEEHHHHH	14.10	26074081
328	Phosphorylation	RPPQKIVSPKQEHED CCCHHCCCCCCCCCH	29.83	24719451
410	Phosphorylation	PPDKRRNSELFQTLI CCCCCCCHHHHHHHH	33.59	30266825
415	Phosphorylation	RNSELFQTLISKSRE CCHHHHHHHHHHHHC	20.80	23312004

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of KCTD8_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of KCTD8_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of KCTD8_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of KCTD8_HUMAN !!

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.