KBRS1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: KBRS1_MOUSE
• UniProt AC: Q8CEC5
• Protein Name: NF-kappa-B inhibitor-interacting Ras-like protein 1
• Gene Name: Nkiras1
• Organism: Mus musculus (Mouse).
• Sequence Length: 192
• Subcellular Localization: Cytoplasm.
• Protein Description: Atypical Ras-like protein that acts as a potent regulator of NF-kappa-B activity by preventing the degradation of NF-kappa-B inhibitor beta (NFKBIB) by most signals, explaining why NFKBIB is more resistant to degradation. May act by blocking phosphorylation of NFKBIB and mediating cytoplasmic retention of p65/RELA NF-kappa-B subunit. It is unclear whether it acts as a GTPase. Both GTP- and GDP-bound forms block phosphorylation of NFKBIB (By similarity)..
• Protein Sequence: MGKGCKVVICGLLSVGKTAILEQLLYGNHTIGMEDCETLEDVYMASVETDRGVKEQLHLYDTRGLQKGVELPKHYFSFADGFVLVYSVNNLESFQRVELLKKEIDKFKDKKEVAIVVLGNKLDLSEQRQVDADVAQQWARSEKVKLWEVTVTDRRTLIEPFTLLASKLSQPQSKSSFPLPGRKNKGNSNPEN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
37	Ubiquitination	TIGMEDCETLEDVYM CCCHHHCCCHHHHHH	69.61	27667366
41	Ubiquitination	EDCETLEDVYMASVE HHCCCHHHHHHCEEE	39.70	27667366
67	Ubiquitination	YDTRGLQKGVELPKH ECCCCCCCCCCCCCH	70.71	27667366
144	Ubiquitination	QWARSEKVKLWEVTV HHHHHCCCEEEEEEE	5.59	27667366
148	Ubiquitination	SEKVKLWEVTVTDRR HCCCEEEEEEECCCC	38.45	27667366
167	Ubiquitination	PFTLLASKLSQPQSK HHHHHHHHHCCCCCC	46.69	-
174	Ubiquitination	KLSQPQSKSSFPLPG HHCCCCCCCCCCCCC	44.89	27667366

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of KBRS1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of KBRS1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of KBRS1_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of KBRS1_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.