KAD6_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: KAD6_DROME
• UniProt AC: Q7JYV7
• Protein Name: Adenylate kinase isoenzyme 6 homolog {ECO:0000255|HAMAP-Rule:MF_03173}
• Gene Name: Ak6
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 175
• Subcellular Localization: Nucleus .
• Protein Description: Broad-specificity nucleoside monophosphate (NMP) kinase that catalyzes the reversible transfer of the terminal phosphate group between nucleoside triphosphates and monophosphates. AMP is the best phosphate acceptor, and CMP is also a good substrate. All nucleoside triphosphates ATP, TTP, CTP, GTP, and UTP are accepted as phosphate donors. ATP is the best phosphate donor. May have a role in nuclear energy homeostasis..
• Protein Sequence: MSEPEPDVKPNILITGTPGAGKSYLCERIASELKFEWLDCSKIAKEKNFVEEYDEEYDCPILDEEKLMDHLEPLMAKGGNVVEYHGCDFFPERWFQAVFVVTCPNTTLYDRLKERNYNEKKLASNIQCEIFGTILEEARDSYKSDIVFELKGETKADAHISIKTVKNWYRMWKRK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
163	Acetylation	ADAHISIKTVKNWYR CCCEEEHHHHHHHHH		21791702

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of KAD6_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of KAD6_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of KAD6_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.