| UniProt ID | KAD1_MOUSE | |
|---|---|---|
| UniProt AC | Q9R0Y5 | |
| Protein Name | Adenylate kinase isoenzyme 1 {ECO:0000255|HAMAP-Rule:MF_03171} | |
| Gene Name | Ak1 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 194 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Also possesses broad nucleoside diphosphate kinase activity. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism (By similarity). May provide a mechanism to buffer the adenylate energy charge for sperm motility.. | |
| Protein Sequence | MEEKLKKAKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSERGKKLSAIMEKGELVPLDTVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEEFEQKIGQPTLLLYVDAGAETMTQRLLKRGETSGRVDDNEETIKKRLETYYNATEPVISFYDKRGIVRKVNAEGTVDTVFSEVCTYLDSLK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MEEKLKKA -------CHHHHHCC | 15.75 | - | |
| 19 | Phosphorylation | FVVGGPGSGKGTQCE EEECCCCCCCHHHHH | 40.23 | 28464351 | |
| 21 | Ubiquitination | VGGPGSGKGTQCEKI ECCCCCCCHHHHHHH | 61.56 | 22790023 | |
| 21 (in isoform 2) | Ubiquitination | - | 61.56 | 22790023 | |
| 25 | S-nitrosocysteine | GSGKGTQCEKIVQKY CCCCHHHHHHHHHHH | 6.05 | - | |
| 25 | S-nitrosylation | GSGKGTQCEKIVQKY CCCCHHHHHHHHHHH | 6.05 | 21278135 | |
| 27 | Ubiquitination | GKGTQCEKIVQKYGY CCHHHHHHHHHHHCC | 56.66 | - | |
| 27 | Acetylation | GKGTQCEKIVQKYGY CCHHHHHHHHHHHCC | 56.66 | 22826441 | |
| 31 | Acetylation | QCEKIVQKYGYTHLS HHHHHHHHHCCCCCC | 29.74 | 21728379 | |
| 31 | Ubiquitination | QCEKIVQKYGYTHLS HHHHHHHHHCCCCCC | 29.74 | 22790023 | |
| 31 (in isoform 2) | Ubiquitination | - | 29.74 | 22790023 | |
| 32 | Phosphorylation | CEKIVQKYGYTHLST HHHHHHHHCCCCCCH | 9.77 | 29514104 | |
| 34 | Phosphorylation | KIVQKYGYTHLSTGD HHHHHHCCCCCCHHH | 6.46 | 29514104 | |
| 35 | Phosphorylation | IVQKYGYTHLSTGDL HHHHHCCCCCCHHHH | 16.39 | 29550500 | |
| 37 (in isoform 2) | Ubiquitination | - | 3.65 | - | |
| 38 | Phosphorylation | KYGYTHLSTGDLLRA HHCCCCCCHHHHEEE | 23.80 | 26824392 | |
| 39 | Phosphorylation | YGYTHLSTGDLLRAE HCCCCCCHHHHEEEE | 40.86 | 23737553 | |
| 47 (in isoform 2) | Ubiquitination | - | 5.57 | - | |
| 48 | Phosphorylation | DLLRAEVSSGSERGK HHEEEECCCCCHHHH | 22.08 | 28542873 | |
| 51 | Phosphorylation | RAEVSSGSERGKKLS EEECCCCCHHHHHHH | 26.52 | 28542873 | |
| 56 | Ubiquitination | SGSERGKKLSAIMEK CCCHHHHHHHHHHHC | 50.96 | 22790023 | |
| 56 (in isoform 2) | Ubiquitination | - | 50.96 | 22790023 | |
| 58 | Phosphorylation | SERGKKLSAIMEKGE CHHHHHHHHHHHCCC | 25.32 | 26824392 | |
| 72 (in isoform 2) | Ubiquitination | - | 4.21 | - | |
| 83 (in isoform 2) | Ubiquitination | - | 42.48 | 22790023 | |
| 83 | Ubiquitination | LRDAMLAKVDSSNGF HHHHHHHCCCCCCCE | 42.48 | 22790023 | |
| 86 | Phosphorylation | AMLAKVDSSNGFLID HHHHCCCCCCCEEEC | 28.79 | 25293948 | |
| 87 | Phosphorylation | MLAKVDSSNGFLIDG HHHCCCCCCCEEECC | 36.19 | 25293948 | |
| 99 (in isoform 2) | Ubiquitination | - | 6.23 | - | |
| 100 (in isoform 2) | Ubiquitination | - | 48.08 | 22790023 | |
| 100 | Ubiquitination | DGYPREVKQGEEFEQ CCCCCCCCCHHHHHH | 48.08 | 22790023 | |
| 116 | Ubiquitination | IGQPTLLLYVDAGAE HCCCEEEEEEECCCH | 4.39 | 27667366 | |
| 116 (in isoform 2) | Ubiquitination | - | 4.39 | - | |
| 124 | Ubiquitination | YVDAGAETMTQRLLK EEECCCHHHHHHHHH | 25.61 | 27667366 | |
| 135 | Phosphorylation | RLLKRGETSGRVDDN HHHHCCCCCCCCCCC | 39.03 | 15668135 | |
| 136 | Phosphorylation | LLKRGETSGRVDDNE HHHCCCCCCCCCCCH | 21.94 | 22210690 | |
| 145 | Phosphorylation | RVDDNEETIKKRLET CCCCCHHHHHHHHHH | 31.73 | 22210690 | |
| 147 (in isoform 2) | Ubiquitination | - | 38.98 | 22790023 | |
| 147 | Ubiquitination | DDNEETIKKRLETYY CCCHHHHHHHHHHHH | 38.98 | 22790023 | |
| 148 (in isoform 2) | Ubiquitination | - | 59.36 | 22790023 | |
| 148 | Ubiquitination | DNEETIKKRLETYYN CCHHHHHHHHHHHHC | 59.36 | 22790023 | |
| 152 | Phosphorylation | TIKKRLETYYNATEP HHHHHHHHHHCCCCC | 35.58 | 50564315 | |
| 153 | Phosphorylation | IKKRLETYYNATEPV HHHHHHHHHCCCCCE | 5.83 | 29514104 | |
| 163 | Ubiquitination | ATEPVISFYDKRGIV CCCCEEEEECCCCCE | 6.68 | 27667366 | |
| 163 (in isoform 2) | Ubiquitination | - | 6.68 | - | |
| 164 (in isoform 2) | Ubiquitination | - | 17.48 | - | |
| 166 (in isoform 2) | Ubiquitination | - | 40.94 | 22790023 | |
| 166 | Ubiquitination | PVISFYDKRGIVRKV CEEEEECCCCCEEEE | 40.94 | 22790023 | |
| 166 | Acetylation | PVISFYDKRGIVRKV CEEEEECCCCCEEEE | 40.94 | 21728379 | |
| 171 | Ubiquitination | YDKRGIVRKVNAEGT ECCCCCEEEECCCCC | 34.97 | 27667366 | |
| 181 | Phosphorylation | NAEGTVDTVFSEVCT CCCCCHHHHHHHHHH | 21.08 | 22210690 | |
| 182 (in isoform 2) | Ubiquitination | - | 4.26 | - | |
| 184 | Phosphorylation | GTVDTVFSEVCTYLD CCHHHHHHHHHHHHH | 25.45 | 22210690 | |
| 187 | S-nitrosylation | DTVFSEVCTYLDSLK HHHHHHHHHHHHHCC | 1.49 | 21278135 | |
| 187 | S-nitrosocysteine | DTVFSEVCTYLDSLK HHHHHHHHHHHHHCC | 1.49 | - | |
| 188 | Phosphorylation | TVFSEVCTYLDSLK- HHHHHHHHHHHHCC- | 32.09 | 22210690 | |
| 192 | Phosphorylation | EVCTYLDSLK----- HHHHHHHHCC----- | 35.15 | 30991467 | |
| 194 | Acetylation | CTYLDSLK------- HHHHHHCC------- | 63.35 | 19863703 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KAD1_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KAD1_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KAD1_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of KAD1_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...