UniProt ID | KAD1_ARATH | |
---|---|---|
UniProt AC | Q9ZUU1 | |
Protein Name | Adenylate kinase 1, chloroplastic | |
Gene Name | ADK | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 284 | |
Subcellular Localization | Plastid, chloroplast stroma . | |
Protein Description | Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis, adenine nucleotide metabolism and plant growth.. | |
Protein Sequence | MARLVRVARSSSLFGFGNRFYSTSAEASHASSPSPFLHGGGASRVAPKDRNVQWVFLGCPGVGKGTYASRLSTLLGVPHIATGDLVREELASSGPLSQKLSEIVNQGKLVSDEIIVDLLSKRLEAGEARGESGFILDGFPRTMRQAEILGDVTDIDLVVNLKLPEEVLVDKCLGRRTCSQCGKGFNVAHINLKGENGRPGISMDPLLPPHQCMSKLVTRADDTEEVVKARLRIYNETSQPLEEYYRTKGKLMEFDLPGGIPESWPRLLEALRLDDYEEKQSVAA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of KAD1_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KAD1_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KAD1_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KAD1_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
KIN10_ARATH | KIN10 | physical | 24498147 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...