dbPTM

K2C73_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	K2C73_MOUSE
UniProt AC	Q6NXH9
Protein Name	Keratin, type II cytoskeletal 73
Gene Name	Krt73
Organism	Mus musculus (Mouse).
Sequence Length	539
Subcellular Localization
Protein Description	Has a role in hair formation. Specific component of keratin intermediate filaments in the inner root sheath (IRS) of the hair follicle (By similarity)..
Protein Sequence	MNRQFTCKPGVANRGFSGCSAVLSGGSSSSYRAAGKGLSGGFSSRSLYSLRSPRSISFNVASSSGRTGGYGFGRNRASGFAGSMFGSGALGPSNPSLCLPGGIHQVTVNKSLLAPLNVELDPEIQKVRAQEREQIKALNNKFASFIDKVRFLEQQNQVLQTKWELLQQLDLSNCRRNLEPVYEAHISSLQKQLDSLSGDRVRLDSELRGMRDAVEDCKKRYEEEINKRTTAENEFVVLKKDVDAAYMSKVELQAKVDALDGEIKFLKCLYEGEITQMQSHISDTSVVLSMDNNRNLDLDSIIAEVRAQYEDIALKSKAEAEMVYQTKFQELQLAAGRHGDDLKHTRNEISELTRLIQRLRSEIESVKKQCSNLETAIADAEQRGDCALKDARAKLDELERALHQAKEELARMLREHQELMSMKLALDIEIATYRKLLEGEECRMSGEHTSAVSISVISSSAPGTVGAGTSFGFSSAGTYGYRQSSVAGGYGILSGGCVTGSGNCSPRGDTKNRLGSASEFKEVSGKTLALGSPSKKTMR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
144	Phosphorylation	ALNNKFASFIDKVRF HHHHHHHHHHHHHHH	26.35	29472430
148	Ubiquitination	KFASFIDKVRFLEQQ HHHHHHHHHHHHHHH	30.41	27667366
248	Phosphorylation	DVDAAYMSKVELQAK CCCHHHHCCCHHHHH	22.37	20139300
421	Phosphorylation	REHQELMSMKLALDI HHHHHHHHHHHHHHH	25.95	29899451
435	Ubiquitination	IEIATYRKLLEGEEC HHHHHHHHHHCCCCC	47.19	27667366

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of K2C73_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of K2C73_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of K2C73_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of K2C73_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of K2C73_MOUSE

Related Literatures of Post-Translational Modification