dbPTM

K1H2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	K1H2_MOUSE
UniProt AC	Q62168
Protein Name	Keratin, type I cuticular Ha2
Gene Name	Krt32
Organism	Mus musculus (Mouse).
Sequence Length	407
Subcellular Localization
Protein Description
Protein Sequence	MPSVCMPTTYRPASCLSKTYLSSSCQPSNRRPTGCISSSMGTYGLFCEGAFNGNEKETMQVLNDRLANYLEKVRQLEKENAELEGKIQDVYQGQVLTMCPDYQSYFQTIEELQQKVLCTKAENARMIVHIDNAKLAADDFRTKYETELALRQLVEADTNGLRRILDELTLNKADLEAQVESLKEELLCLKRNHEEEVGVLRQQLGDRLNIEVDAAPPVDLTRMLEEMRCQYETMVETNHRDVEEWFNMQMEELNKQVATSSEQLQSYQSDIIDLRRTVNTLEIELQAQHSLRDSLENTLGETEGRFTSQLSQMQCMITNVESQLSDIRCDLERQNQEYKVLLDVKARLECEIDTYRGLLESEDSKLPCNPCSTPSCQPCAPSPGVSRTVCVPHTVCVPCSPCLQTRY

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
181	Phosphorylation	DLEAQVESLKEELLC HHHHHHHHHHHHHHH	45.98	23737553
339	Acetylation	ERQNQEYKVLLDVKA HHCCCEEEEEEEHHH	26.17	21728379

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of K1H2_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of K1H2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of K1H2_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of K1H2_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of K1H2_MOUSE

Related Literatures of Post-Translational Modification