UniProt ID | K1C25_MOUSE | |
---|---|---|
UniProt AC | Q8VCW2 | |
Protein Name | Keratin, type I cytoskeletal 25 | |
Gene Name | Krt25 {ECO:0000312|EMBL:AAH18391.1, ECO:0000312|MGI:MGI:1918060} | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 446 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Essential for the proper assembly of type I and type II keratin protein complexes and formation of keratin intermediate filaments in the inner root sheath (irs). [PubMed: 14996088] | |
Protein Sequence | MSLRLSSGSRRSYARPSTGSLRGASFGAGNACGVAGIGSGFSCAFGGSSTGGNTGVANSCAGFTVNEGGLLSGNEKVTMQNLNDRLASYLDNVQALQEANADLEQKIKGWYEKFGPGSCRGLDHDYSRYFPIIDDLKNQIITSTTSNANAVLQIDNARLTADDFRLKYENELALHQSVEADVNGLRRVLDEITLCRTDLEIQYETLSEELTYLKKNHKEEMQALQCAAGGNVNVEMNAAPGVDLTVLLNNMRAEYEALAEQNRRDAEAWFQEKSASLQQQITEDVGATTSARNELTEMKRTLQTLEIELQSLLATKHSLECSLTETEGNYCTQLAQIQAQISALEEQLHQVRTETEGQKLEYEQLLNVKAHLEKEIETYCLLIGGDEGACKSSSYKSKDYGSGNAGNQIKDPVKAIVVKKVLEEVDQRSKILTTRLHSLEEKSQSN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
245 | Phosphorylation | AAPGVDLTVLLNNMR CCCCCCHHHHHHHHH | 12.49 | 17203969 | |
402 | Phosphorylation | YKSKDYGSGNAGNQI CCCCCCCCCCCCCCC | 23.73 | 23375375 | |
438 | Phosphorylation | ILTTRLHSLEEKSQS HHHHHHHHHHHHHHC | 41.91 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of K1C25_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of K1C25_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of K1C25_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of K1C25_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...