dbPTM

K1C25_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	K1C25_MOUSE
UniProt AC	Q8VCW2
Protein Name	Keratin, type I cytoskeletal 25
Gene Name	Krt25 {ECO:0000312\|EMBL:AAH18391.1, ECO:0000312\|MGI:MGI:1918060}
Organism	Mus musculus (Mouse).
Sequence Length	446
Subcellular Localization	Cytoplasm .
Protein Description	Essential for the proper assembly of type I and type II keratin protein complexes and formation of keratin intermediate filaments in the inner root sheath (irs). [PubMed: 14996088]
Protein Sequence	MSLRLSSGSRRSYARPSTGSLRGASFGAGNACGVAGIGSGFSCAFGGSSTGGNTGVANSCAGFTVNEGGLLSGNEKVTMQNLNDRLASYLDNVQALQEANADLEQKIKGWYEKFGPGSCRGLDHDYSRYFPIIDDLKNQIITSTTSNANAVLQIDNARLTADDFRLKYENELALHQSVEADVNGLRRVLDEITLCRTDLEIQYETLSEELTYLKKNHKEEMQALQCAAGGNVNVEMNAAPGVDLTVLLNNMRAEYEALAEQNRRDAEAWFQEKSASLQQQITEDVGATTSARNELTEMKRTLQTLEIELQSLLATKHSLECSLTETEGNYCTQLAQIQAQISALEEQLHQVRTETEGQKLEYEQLLNVKAHLEKEIETYCLLIGGDEGACKSSSYKSKDYGSGNAGNQIKDPVKAIVVKKVLEEVDQRSKILTTRLHSLEEKSQSN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
245	Phosphorylation	AAPGVDLTVLLNNMR CCCCCCHHHHHHHHH	12.49	17203969
402	Phosphorylation	YKSKDYGSGNAGNQI CCCCCCCCCCCCCCC	23.73	23375375
438	Phosphorylation	ILTTRLHSLEEKSQS HHHHHHHHHHHHHHC	41.91	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of K1C25_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of K1C25_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of K1C25_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of K1C25_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of K1C25_MOUSE

Related Literatures of Post-Translational Modification