UniProt ID | JAZF1_HUMAN | |
---|---|---|
UniProt AC | Q86VZ6 | |
Protein Name | Juxtaposed with another zinc finger protein 1 | |
Gene Name | JAZF1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 243 | |
Subcellular Localization | Nucleus . | |
Protein Description | Acts as a transcriptional corepressor of orphan nuclear receptor NR2C2. [PubMed: 15302918 Inhibits expression of the gluconeogenesis enzyme PCK2 through inhibition of NR2C2 activity (By similarity Also involved in transcriptional activation of NAMPT by promoting expression of PPARA and PPARD (By similarity Plays a role in lipid metabolism by suppressing lipogenesis, increasing lipolysis and decreasing lipid accumulation in adipose tissue (By similarity Plays a role in glucose homeostasis by improving glucose metabolism and insulin sensitivity (By similarity] | |
Protein Sequence | MTGIAAASFFSNTCRFGGCGLHFPTLADLIEHIEDNHIDTDPRVLEKQELQQPTYVALSYINRFMTDAARREQESLKKKIQPKLSLTLSSSVSRGNVSTPPRHSSGSLTPPVTPPITPSSSFRSSTPTGSEYDEEEVDYEESDSDESWTTESAISSEAILSSMCMNGGEEKPFACPVPGCKKRYKNVNGIKYHAKNGHRTQIRVRKPFKCRCGKSYKTAQGLRHHTINFHPPVSAEIIRKMQQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
34 (in isoform 2) | Ubiquitination | - | 55.45 | 21890473 | |
47 | Ubiquitination | TDPRVLEKQELQQPT CCHHHHHHHHHCCCC | 44.93 | 21890473 | |
47 (in isoform 1) | Ubiquitination | - | 44.93 | 21890473 | |
47 | Ubiquitination | TDPRVLEKQELQQPT CCHHHHHHHHHCCCC | 44.93 | 22817900 | |
55 | Phosphorylation | QELQQPTYVALSYIN HHHCCCCHHHHHHHH | 7.15 | - | |
85 | Phosphorylation | KKIQPKLSLTLSSSV HHHCCCEEEEECCCC | 25.98 | 24719451 | |
98 | Phosphorylation | SVSRGNVSTPPRHSS CCCCCCCCCCCCCCC | 38.91 | 23312004 | |
99 | Phosphorylation | VSRGNVSTPPRHSSG CCCCCCCCCCCCCCC | 32.79 | 23312004 | |
104 | Phosphorylation | VSTPPRHSSGSLTPP CCCCCCCCCCCCCCC | 37.36 | 23663014 | |
105 | Phosphorylation | STPPRHSSGSLTPPV CCCCCCCCCCCCCCC | 26.69 | 23663014 | |
107 | Phosphorylation | PPRHSSGSLTPPVTP CCCCCCCCCCCCCCC | 30.90 | 23663014 | |
109 | Phosphorylation | RHSSGSLTPPVTPPI CCCCCCCCCCCCCCC | 27.52 | 23927012 | |
113 | Phosphorylation | GSLTPPVTPPITPSS CCCCCCCCCCCCCCH | 29.17 | 23927012 | |
117 | Phosphorylation | PPVTPPITPSSSFRS CCCCCCCCCCHHCCC | 23.92 | 23663014 | |
119 | Phosphorylation | VTPPITPSSSFRSST CCCCCCCCHHCCCCC | 29.93 | 23663014 | |
120 | Phosphorylation | TPPITPSSSFRSSTP CCCCCCCHHCCCCCC | 34.40 | 23663014 | |
121 | Phosphorylation | PPITPSSSFRSSTPT CCCCCCHHCCCCCCC | 29.08 | 23663014 | |
191 | Ubiquitination | YKNVNGIKYHAKNGH EECCCCEEEEEECCC | 32.17 | 29967540 | |
216 | Phosphorylation | KCRCGKSYKTAQGLR ECCCCCCCCCCCCCC | 18.82 | 21403953 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of JAZF1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of JAZF1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of JAZF1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PPARG_HUMAN | PPARG | physical | 15302918 | |
RXRA_HUMAN | RXRA | physical | 15302918 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions."; Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.; Sci. Signal. 2:RA46-RA46(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-109 AND THR-113, ANDMASS SPECTROMETRY. |