UniProt ID | JAM3_RAT | |
---|---|---|
UniProt AC | Q68FQ2 | |
Protein Name | Junctional adhesion molecule C | |
Gene Name | Jam3 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 310 | |
Subcellular Localization |
Cell membrane Single-pass type I membrane protein . Cell junction, desmosome . Secreted, extracellular space . |
|
Protein Description | May participate in cell-cell adhesion distinct from tight junctions.. | |
Protein Sequence | MALSRRLRLRLCARLPDFFLLLLFRGCVIEAVNLKSSNRNPVVHEFESVELSCIITDSQTNDPRIEWKKIQDGQTTYVYFDNKIQGDLAGRTDVFGKTSLRIWNVTRSDSAIYRCEVVALNDRKEVDELTIELIVQVKPVAPVCRVPKAVPVGKAATLQCQESEGYPRPYYSWYRNDVPLPTDSRANPRFQNSSFHVNSETGTLVFSAVHKEDSGQYYCIASNDAGAARCEGQDMEVYDLNIAGIIGGVLVVLIVLAVITMGICCAYRRGCFISSKQDGESYKSPGKHEGVNYIRTSEEGDFRHKSSFVI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
104 | N-linked_Glycosylation | KTSLRIWNVTRSDSA CEEEEEEEECCCCCE | 23.94 | - | |
192 | N-linked_Glycosylation | RANPRFQNSSFHVNS CCCCCCCCCCEEEEC | 36.59 | 24090084 | |
264 | S-palmitoylation | AVITMGICCAYRRGC HHHHHHHHHHHHCCC | 0.62 | - | |
265 | S-palmitoylation | VITMGICCAYRRGCF HHHHHHHHHHHCCCE | 3.35 | - | |
287 | Ubiquitination | ESYKSPGKHEGVNYI CCCCCCCCCCCCCEE | 41.70 | - | |
293 | Phosphorylation | GKHEGVNYIRTSEEG CCCCCCCEEECCCCC | 6.86 | 25575281 | |
296 | Phosphorylation | EGVNYIRTSEEGDFR CCCCEEECCCCCCCC | 30.82 | 25575281 | |
297 | Phosphorylation | GVNYIRTSEEGDFRH CCCEEECCCCCCCCC | 24.65 | 25575281 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of JAM3_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of JAM3_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of JAM3_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of JAM3_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...