UniProt ID | JAL33_ARATH | |
---|---|---|
UniProt AC | O04311 | |
Protein Name | Jacalin-related lectin 33 | |
Gene Name | JAL33 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 300 | |
Subcellular Localization | ||
Protein Description | Sugar-binding protein showing significant affinity for (Glc alpha(1-4)Glc)(3) maltohexaose, (Glc alpha(1-6)Glc)(3) isomaltohexaose, Gal alpha(1-4)Gal beta(1-4)Glc, GalNAc alpha(1-3)(Fuc alpha(1-2)) and Gal beta(1-3)(Fuc alpha(1-4))GlcNAc beta(1-3)Gal beta(1-4)Glc.. | |
Protein Sequence | MAQKVEAGGGAGGASWDDGVHDGVRKVHVGQGQDGVSSINVVYAKDSQDVEGGEHGKKTLLGFETFEVDADDYIVAVQVTYDNVFGQDSDIITSITFNTFKGKTSPPYGLETQKKFVLKDKNGGKLVGFHGRAGEALYALGAYFATTTTPVTPAKKLSAIGGDEGTAWDDGAYDGVKKVYVGQGQDGISAVKFEYNKGAENIVGGEHGKPTLLGFEEFEIDYPSEYITAVEGTYDKIFGSDGLIITMLRFKTNKQTSAPFGLEAGTAFELKEEGHKIVGFHGKASELLHQFGVHVMPLTN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of JAL33_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of JAL33_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of JAL33_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of JAL33_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...