UniProt ID | JAL31_ARATH | |
---|---|---|
UniProt AC | O04313 | |
Protein Name | PYK10-binding protein 2 | |
Gene Name | PBP2 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 296 | |
Subcellular Localization | ||
Protein Description | Polymerizer-type lectin that may facilitate the correct polymerization of BGLU23/PYK10 upon tissue damage. Activates BGLU21, BGLU22 and BGLU23.. | |
Protein Sequence | MAQKVEAKGGKGGNQWDDGSDHDAVTKIQVAVGGMGIQYIQFDYVKNGQTEQTPLRGIKGSTIPTDPFVINHPEEHLVSIEIWYKPDGLIQGLRFISNKKTSRFIGYDRGTRSFLQVQDKKIIGFHGSAGDNLNSLGAYFAPLTIPLTPAKPLPALGSDDGTAWDDGAYVGVKKVYVGQAQDGISAVKFVYDKSPEEVTGEEHGKSTLLGFEEFVLDYPSEYIIAVEGTYDKIFGSDGSVITMLRFKTNKQTSPPFGLEAGTAFELKEEGHKIVGFHGRADALLHKIGVHVRPVSN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAQKVEAKG ------CCCEEECCC | - | ||
176 | Phosphorylation | YVGVKKVYVGQAQDG EEEEEEEEEEECCCC | 22092075 | ||
191 | Phosphorylation | ISAVKFVYDKSPEEV EEEEEEEECCCHHHH | 23776212 | ||
194 | Phosphorylation | VKFVYDKSPEEVTGE EEEEECCCHHHHCCC | 30407730 | ||
199 | Phosphorylation | DKSPEEVTGEEHGKS CCCHHHHCCCCCCCE | 30407730 | ||
236 | Phosphorylation | TYDKIFGSDGSVITM ECCCCCCCCCCEEEE | 30407730 | ||
239 | Phosphorylation | KIFGSDGSVITMLRF CCCCCCCCEEEEEEE | 30407730 | ||
253 | Phosphorylation | FKTNKQTSPPFGLEA EECCCCCCCCCCCCC | 22092075 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of JAL31_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of JAL31_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of JAL31_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of JAL31_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...