UniProt ID | JAL30_ARATH | |
---|---|---|
UniProt AC | O04314 | |
Protein Name | PYK10-binding protein 1 | |
Gene Name | PBP1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 298 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Inhibitor-type lectin that may regulate the correct polymerization of BGLU23/PYK10 upon tissue damage. Activates BGLU21, BGLU22 and BGLU23.. | |
Protein Sequence | MAQKVEAQGGKGANLWDDGSTHDAVTKIQLAAGIDGIQYVQFDYVKNGQPEQAPLRGTKGRVLPADPFVINHPDEHLVSVEGWYSPEGIIQGIKFISNKKTSDVIGSDEGTHFTLQVKDKKIIGFHGSAGGNLNSLGAYFAPLTTTTPLTPAKQLTAFGSDDGTVWDDGAYVGVKKVYVGQAQDGISAVKFVYDKSPEEVTGEEHGKSTLLGFEEFVLDYPSEYITAVDGTYDKIFGSDGSVITMLRFKTNKQTSPPFGLEAGTVFELKEEGHKIVGFHGRADVLLHKIGVHVRPLSN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAQKVEAQG ------CCCCCCCCC | - | ||
20 | Phosphorylation | ANLWDDGSTHDAVTK CCCCCCCCCCHHHHH | 23776212 | ||
21 | Phosphorylation | NLWDDGSTHDAVTKI CCCCCCCCCHHHHHH | 23776212 | ||
26 | Phosphorylation | GSTHDAVTKIQLAAG CCCCHHHHHHHHHHC | 23776212 | ||
102 | Phosphorylation | FISNKKTSDVIGSDE EECCCCCCCEECCCC | 22092075 | ||
156 | Phosphorylation | LTPAKQLTAFGSDDG CCCHHHEEECCCCCC | 23776212 | ||
160 | Phosphorylation | KQLTAFGSDDGTVWD HHEEECCCCCCCEEC | 23776212 | ||
164 | Phosphorylation | AFGSDDGTVWDDGAY ECCCCCCCEECCCCE | 23776212 | ||
178 | Phosphorylation | YVGVKKVYVGQAQDG EEEEEEEEEEECCCC | 22092075 | ||
193 | Phosphorylation | ISAVKFVYDKSPEEV EEEEEEEECCCHHHH | 23776212 | ||
196 | Phosphorylation | VKFVYDKSPEEVTGE EEEEECCCHHHHCCC | 30407730 | ||
201 | Phosphorylation | DKSPEEVTGEEHGKS CCCHHHHCCCCCCCE | 30407730 | ||
238 | Phosphorylation | TYDKIFGSDGSVITM CCCCCCCCCCCEEEE | 30407730 | ||
241 | Phosphorylation | KIFGSDGSVITMLRF CCCCCCCCEEEEEEE | 30407730 | ||
255 | Phosphorylation | FKTNKQTSPPFGLEA EECCCCCCCCCCCCC | 22092075 | ||
297 | Phosphorylation | GVHVRPLSN------ EEEEEECCC------ | 23776212 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of JAL30_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of JAL30_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of JAL30_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of JAL30_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...