| UniProt ID | JAL30_ARATH | |
|---|---|---|
| UniProt AC | O04314 | |
| Protein Name | PYK10-binding protein 1 | |
| Gene Name | PBP1 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 298 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | Inhibitor-type lectin that may regulate the correct polymerization of BGLU23/PYK10 upon tissue damage. Activates BGLU21, BGLU22 and BGLU23.. | |
| Protein Sequence | MAQKVEAQGGKGANLWDDGSTHDAVTKIQLAAGIDGIQYVQFDYVKNGQPEQAPLRGTKGRVLPADPFVINHPDEHLVSVEGWYSPEGIIQGIKFISNKKTSDVIGSDEGTHFTLQVKDKKIIGFHGSAGGNLNSLGAYFAPLTTTTPLTPAKQLTAFGSDDGTVWDDGAYVGVKKVYVGQAQDGISAVKFVYDKSPEEVTGEEHGKSTLLGFEEFVLDYPSEYITAVDGTYDKIFGSDGSVITMLRFKTNKQTSPPFGLEAGTVFELKEEGHKIVGFHGRADVLLHKIGVHVRPLSN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MAQKVEAQG ------CCCCCCCCC | - | ||
| 20 | Phosphorylation | ANLWDDGSTHDAVTK CCCCCCCCCCHHHHH | 23776212 | ||
| 21 | Phosphorylation | NLWDDGSTHDAVTKI CCCCCCCCCHHHHHH | 23776212 | ||
| 26 | Phosphorylation | GSTHDAVTKIQLAAG CCCCHHHHHHHHHHC | 23776212 | ||
| 102 | Phosphorylation | FISNKKTSDVIGSDE EECCCCCCCEECCCC | 22092075 | ||
| 156 | Phosphorylation | LTPAKQLTAFGSDDG CCCHHHEEECCCCCC | 23776212 | ||
| 160 | Phosphorylation | KQLTAFGSDDGTVWD HHEEECCCCCCCEEC | 23776212 | ||
| 164 | Phosphorylation | AFGSDDGTVWDDGAY ECCCCCCCEECCCCE | 23776212 | ||
| 178 | Phosphorylation | YVGVKKVYVGQAQDG EEEEEEEEEEECCCC | 22092075 | ||
| 193 | Phosphorylation | ISAVKFVYDKSPEEV EEEEEEEECCCHHHH | 23776212 | ||
| 196 | Phosphorylation | VKFVYDKSPEEVTGE EEEEECCCHHHHCCC | 30407730 | ||
| 201 | Phosphorylation | DKSPEEVTGEEHGKS CCCHHHHCCCCCCCE | 30407730 | ||
| 238 | Phosphorylation | TYDKIFGSDGSVITM CCCCCCCCCCCEEEE | 30407730 | ||
| 241 | Phosphorylation | KIFGSDGSVITMLRF CCCCCCCCEEEEEEE | 30407730 | ||
| 255 | Phosphorylation | FKTNKQTSPPFGLEA EECCCCCCCCCCCCC | 22092075 | ||
| 297 | Phosphorylation | GVHVRPLSN------ EEEEEECCC------ | 23776212 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of JAL30_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of JAL30_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of JAL30_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of JAL30_ARATH !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
